DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and igsf9ba

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio

Alignment Length:398 Identity:98/399 (25%)
Similarity:150/399 (38%) Gaps:93/399 (23%)


  Fly    80 SGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKN-----L 139
            |..|:...|::|                 |.|||:|      ||..||.:|.|||.|.:     .
Zfish    14 STRGTAAQGAHG-----------------VREEPQF------VTARAGESVVLGCDVSHPLNGQQ 55

  Fly   140 GSYKVAWMHFEQSAILTVH-----NHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQ 199
            ..|.|.|..|.......::     .||   :|..:.....|.:..   |.|..|..||:|.|.|:
Zfish    56 TPYVVEWFKFGVPIPFFINFRFYPPHV---DPEYAGRASLHGKAS---LQIEQVRSEDQGWYECR 114

  Fly   200 INTVTAKTQFG--------YLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRD 256
            :  :..:.|:.        :|.|..||...|: ....|..|||.:|:|.|.|.|:|:|::.|.| 
Zfish   115 V--LMLEQQYDTFHNGSWVHLTVNAPPTFSDT-PPQYVEAREGGSITLTCTAFGNPKPVVTWLR- 175

  Fly   257 DNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQ 321
            :..::...:.:.|::   .:|.:..|:|.|.|||.|.|.:.....: ...::.|..||.::.|  
Zfish   176 EGDQLTSTRKYTVSD---GSLTVQAITREDRGAYSCRAHSDQGEAL-HTTRLLVQGPPYIVTP-- 234

  Fly   322 LVGAPEGFNVTIE------CFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTI 380
                ||...|.|.      |..||:|.:|.|....|...::..:..|:...:.:..     .|.|
Zfish   235 ----PENITVNISQNAQFTCQAEAYPGNLTYTWYWEEDNVYFKNDLKLRVRIFIDG-----TLII 290

  Fly   381 INVSSGDDGIYKCVAKNPRG-ETDGIIRLYVSYPPTTAS-----------SGIYS---------T 424
            ..|...|.|.|.|...|..| .......|.|.||....:           |||..         |
Zfish   291 YRVKPEDAGKYTCSPSNSLGISPSASAYLTVQYPARVVNMPPVIYVPRKLSGIIRCPVDANPPVT 355

  Fly   425 DTHWGENG 432
            ...|.::|
Zfish   356 SVRWEKDG 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/114 (25%)
Ig 130..200 CDD:143165 21/80 (26%)
I-set 226..310 CDD:254352 23/84 (27%)
IGc2 233..298 CDD:197706 21/65 (32%)
Ig 313..410 CDD:299845 25/104 (24%)
IG_like 325..410 CDD:214653 22/92 (24%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652 27/97 (28%)
I-set 139..225 CDD:254352 25/92 (27%)
I-set 229..321 CDD:333254 24/103 (23%)
Ig 345..415 CDD:325142 3/20 (15%)
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.