DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and sdk2b

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_009305142.1 Gene:sdk2b ZFINID:ZDB-GENE-030131-8203 Length:2256 Species:Danio rerio

Alignment Length:641 Identity:130/642 (20%)
Similarity:214/642 (33%) Gaps:211/642 (33%)


  Fly     2 LPPSWH----LIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPN 62
            :|||..    |...|::|:..|.|:....:  |.:|...|    ....|:|       .|..|.|
Zfish   181 IPPSSRIAITLDNTLVILSTVAPDAGRYYV--QAVNDKNG----ENKTGQH-------ITLSVEN 232

  Fly    63 FGGAAGNGAGGGGPVAG------------SGTGSTVV----------------GSNGVIVAGG-- 97
            .||.|       .|:|.            |||....:                ..:||:|..|  
Zfish   233 VGGPA-------DPIAPTIVIPPRNTSVISGTSEVTMECVANARPLIKLSISWKKDGVLVRSGLS 290

  Fly    98 --------------------------GANVPTSNLNI---VVEEPEFTEYIE-NVTVPAGRNVKL 132
                                      .::||..:...   |:|.|:|.:..| ::|....:.|.:
Zfish   291 DFNRRLTVLSPAVSDSGFYECEAVLRSSSVPAVSAGAYLHVLEPPQFVKEPEKHITAEMEKVVDI 355

  Fly   133 GCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRT---WYLHINNVHEEDRG 194
            .|..:.:....:.|.                 ...:.::..|..|:|.   ..|.:|.:..:|.|
Zfish   356 PCQARGVPQPDIVWY-----------------KDAVPISPVKTPRYRVLSGGSLQVNGLLPDDTG 403

  Fly   195 RYMC---------QINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPI 250
            .:.|         |.||..|.|.       :.|||....|.|.||  :|.::.|.|..||:|||.
Zfish   404 MFQCFARNQAGEVQTNTYLAVTS-------IAPNITAGPSDSTVI--DGMSVILHCETSGAPRPA 459

  Fly   251 IKWKRDD----NSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN--GVPPTVSKRI--- 306
            |.|::.:    :..:.:.:..::   |..:|.|:.....|.|.|.|:|||  |:....:..:   
Zfish   460 ITWQKGERVLASGSVQLPRFTLL---ESGSLLISPSHISDAGTYTCMASNSRGIDEASADLVVWA 521

  Fly   307 KVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPT-SLNYWTRGEGPIIHDSHKYKVEATVGLP 370
            :..:..||      |.....:|...|:.|.....|: |:.:....:|.:|         .|.|||
Zfish   522 RTRITNPP------QDQSVIKGTKATMTCGVTHDPSVSVRFVWEKDGQVI---------VTQGLP 571

  Fly   371 AYKTHMK--LTIINVSSGDDGIYKCVAKNPRGETDGIIRLYV---SYPPTTASSGIYSTDTHWGE 430
            ..:..:.  |.|....|||.|.|.|...:..|.......|.|   .:.|...|:.:.||:    :
Zfish   572 RLRLDVNGTLHISQTWSGDIGTYTCRVTSVGGNDSRNAHLRVRQLPHAPENPSAVLSSTE----K 632

  Fly   431 NGINNNYAY---GGPDSTRSIYAQDKNT--------------------------RYQSNL---NE 463
            ..||..:|.   |.....|.|....:|.                          .||..|   |:
Zfish   633 RAINLTWAKPFDGNSPLIRYILEVSENNAPWTVLLANIEPESTAVTVNGLIPARSYQFRLCAVND 697

  Fly   464 IGLSEQKSFLDKTQNP----------LLANGNANEA---------DAESNG-ARGH 499
            :|..:.....|:...|          ::|:|..|::         ::..|| .||:
Zfish   698 VGKGQFSKETDRVSLPEEPPSAPPQNVIASGRTNQSIMIQWQPPPESHQNGILRGY 753

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 18/109 (17%)
Ig 130..200 CDD:143165 12/82 (15%)
I-set 226..310 CDD:254352 24/93 (26%)
IGc2 233..298 CDD:197706 21/71 (30%)
Ig 313..410 CDD:299845 24/100 (24%)
IG_like 325..410 CDD:214653 21/88 (24%)
sdk2bXP_009305142.1 IGc2 69..125 CDD:197706
IG_like 70..136 CDD:214653
I-set 147..230 CDD:254352 14/62 (23%)
Ig 156..230 CDD:299845 14/62 (23%)
I-set 242..331 CDD:254352 9/89 (10%)
IGc2 260..313 CDD:197706 4/53 (8%)
I-set 335..424 CDD:254352 19/106 (18%)
Ig 357..424 CDD:299845 14/84 (17%)
I-set 429..519 CDD:254352 28/95 (29%)
Ig 443..519 CDD:299845 21/79 (27%)
I-set 524..613 CDD:254352 24/104 (23%)
Ig 529..613 CDD:299845 23/99 (23%)
FN3 617..707 CDD:238020 16/94 (17%)
fn3 720..803 CDD:278470 7/35 (20%)
FN3 821..917 CDD:238020
FN3 922..1010 CDD:238020
FN3 1020..1114 CDD:238020
fn3 1126..1214 CDD:278470
FN3 1230..1318 CDD:238020
FN3 1328..1421 CDD:238020
FN3 1427..1522 CDD:238020
FN3 1532..1643 CDD:238020
FN3 1653..1746 CDD:238020
FN3 1751..1848 CDD:238020
fn3 1875..1952 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.