DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and paplna

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_005169942.1 Gene:paplna ZFINID:ZDB-GENE-070815-4 Length:1187 Species:Danio rerio

Alignment Length:571 Identity:106/572 (19%)
Similarity:180/572 (31%) Gaps:198/572 (35%)


  Fly    40 GVGTAQGKHPSG-----------SKTVATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVI 93
            ||..|||::..|           |.||.:..|...  ::..|....|..|.|||           
Zfish   651 GVTVAQGQNMEGCPDAWTHWSSSSDTVPSAPVDCH--SSTYGCCYDGVTAASGT----------- 702

  Fly    94 VAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAW---MHFEQSAIL 155
             .|.|.:.|.||                      ....|.|.:.|.......|   .:|::||..
Zfish   703 -HGEGCSNPPSN----------------------TQRSLSCDLPNTVGPCDQWTSRFYFDRSASR 744

  Fly   156 TVH------------------------NHVITRNPRISVTHDKHDRHRTWYLHI----NNVHEED 192
            .:|                        ...:.:..:..|...:|.|.| :..|:    :..|...
Zfish   745 CLHFWYGGCHGNSNNFASEEECQKMCLRSELRQRDQAHVLSLQHGRRR-FPAHVQLSSSGAHRAQ 808

  Fly   193 RGRY-----MCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVRE---GANISLRCRASGSPRP 249
            |...     |.|.|...:.|..|.           |:..:|....|   |..:.|.||.:..|..
Zfish   809 RAHQPASNAMQQSNPAASWTAEGV-----------SIDKTDPSTVEGLVGQRVVLPCRVTPPPSS 862

  Fly   250 --IIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN---------------- 296
              :::|:||.   :.::......:.:|..| :..|:..|.|.:||:|:.                
Zfish   863 AVLVEWRRDG---VPVDPTRHEQQLDGSLL-VGPITLQDSGWFLCVATRDDKRDHRYIYLSVSGS 923

  Fly   297 -----GVPP-------TVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIEC----FTEAHPTSLN 345
                 |:..       |.....:.::|:.|       ||.|..|....::|    .:..|..:: 
Zfish   924 SQNNAGISEVDSSQSYTSQSSSRFNIDYSP-------LVEARAGQTAKLQCSVLPVSAIHAVTI- 980

  Fly   346 YWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYV 410
            :|:|...|:....|....:.|           |.|..:::.|.|:|.|...:.:...:..::|.|
Zfish   981 HWSRAGQPLNSLRHSQHSDGT-----------LVIKQLTADDSGLYTCTVTDAQKFEERQVQLRV 1034

  Fly   411 ------SYPP--------TTASSGIYST----DTHWGENGI----NNNYAYGGPDST---RSIYA 450
                  :..|        :||......|    :..|..||:    :.:..:...|.|   .::.:
Zfish  1035 LGDLRITKAPIDVDVVQGSTAQLACVVTGENVNVGWSRNGVPVRPDGHRVHVSADGTLILNNVQS 1099

  Fly   451 QDKNT----RYQSNLN-----EIGLSE---------QKSFLDKTQNPLLAN 483
            .|:.|    .|...|:     ||.|::         |.|..|....|.|||
Zfish  1100 VDEGTYTCNAYTGTLSVSAAAEIRLAKTPQQDIDGGQFSSSDCVDQPELAN 1150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/132 (15%)
Ig 130..200 CDD:143165 17/106 (16%)
I-set 226..310 CDD:254352 20/117 (17%)
IGc2 233..298 CDD:197706 18/91 (20%)
Ig 313..410 CDD:299845 19/101 (19%)
IG_like 325..410 CDD:214653 16/89 (18%)
paplnaXP_005169942.1 TSP1 24..75 CDD:214559
ADAM_spacer1 181..293 CDD:310520
TSP1 303..356 CDD:214559
TSP1 388..442 CDD:214559
TSP1 449..498 CDD:214559
TSP1 504..557 CDD:214559
KU 720..771 CDD:238057 7/51 (14%)
Ig_3 839..906 CDD:316449 17/71 (24%)
IGc2 960..1022 CDD:197706 14/74 (19%)
I-set 1039..1121 CDD:333254 13/82 (16%)
PLAC 1142..1173 CDD:312271 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.