DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and sdk2a

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_021327143.1 Gene:sdk2a ZFINID:ZDB-GENE-091008-1 Length:2224 Species:Danio rerio

Alignment Length:636 Identity:128/637 (20%)
Similarity:211/637 (33%) Gaps:208/637 (33%)


  Fly     2 LPPSWH----LIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPN 62
            :|||..    |...|::|:..|.|:           |......|....|::.:....:.|  |.|
Zfish   180 IPPSSRIAITLDNTLVILSTVAPDA-----------GRYYAQAVNDKNGENKTSQPVILT--VEN 231

  Fly    63 FGGAAGNGAGGGGPVAGS-----GTGSTVVGS-----------------------NGVIVAGG-- 97
            .||.|       .|:|.|     ...|.:||:                       |||:|..|  
Zfish   232 VGGPA-------DPIAPSIIIPPKNTSVMVGTFEVTLECVANARPLIKLSITWRKNGVLVNRGLR 289

  Fly    98 --------------------------GANVPTSNLNI---VVEEPEFT-EYIENVTVPAGRNVKL 132
                                      .::.|:.:...   |:|.|:|. |...::|....:.|.:
Zfish   290 DFGRRLTISGPLVSDSGYYQCEASLRSSSAPSVSAGAYLHVLEHPQFVKEPDRHITAEMEKVVDI 354

  Fly   133 GCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWY---LHINNVHEEDRG 194
            .|..:.:....:.|.                 ...:.::..|..|:|...   |.||.:..:|.|
Zfish   355 PCQARGVPQPDIVWY-----------------KDAVPISPVKTPRYRVLVGGSLQINGLLPDDTG 402

  Fly   195 RYMC---------QINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPI 250
            .:.|         |.||..|.|.       :.|||....|.|.||  :|.:|.|.|..||:|||.
Zfish   403 MFQCFARNLAGEIQTNTYLAVTS-------IAPNITAGPSDSAVI--DGMSIILHCETSGAPRPA 458

  Fly   251 IKWKRDD----NSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN--GVPPTVSKRI--- 306
            |.|::.:    :..:.:.:..::   |..:|.|:....||.|:|.|:|||  |:....:..:   
Zfish   459 ITWQKAERVLASGSVQLPRFTLL---ESGSLLISPSHLLDAGSYTCMASNSRGIDEASADLVVWA 520

  Fly   307 KVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHP--TSLNYWTRGEGPI-IHDSHKYKVEATVG 368
            :..:..||      |.....:|....:.|.....|  |..:.|.:|...| :..|.:.::::...
Zfish   521 RTRITNPP------QDQSVIKGTKAAMTCGVTHDPSVTVRHIWEKGGAVIDVKSSPRLRLDSNGT 579

  Fly   369 LPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGI 433
            |     |:..|    .|||.|.|.|...:..|.......|.|...| .|...:.:|.:......|
Zfish   580 L-----HISQT----WSGDIGTYTCRVTSVGGNDTRNAHLRVRQLP-HAPENLIATLSISERRTI 634

  Fly   434 NNNYAY---GGPDSTRSIYAQDKNT--------------------------RYQSNL---NEIG- 465
            |..:|.   |.....|.|....:|.                          .||..|   |::| 
Zfish   635 NLTWAQAFDGNSPLIRYILEVSENNAPWTVLLANIEPESISVIVGGLIPARSYQFRLCAVNDVGK 699

  Fly   466 --LSEQKSFLDKTQNP-------LLANGNANEADAESNGARGHNPSMAIAW 507
              .|.:.:.:...:.|       ::|:|..|:             |:.|.|
Zfish   700 GQFSRETARVSLPEEPPSAPPQTVIASGRTNQ-------------SIMIQW 737

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 18/108 (17%)
Ig 130..200 CDD:143165 13/82 (16%)
I-set 226..310 CDD:254352 26/93 (28%)
IGc2 233..298 CDD:197706 23/71 (32%)
Ig 313..410 CDD:299845 22/100 (22%)
IG_like 325..410 CDD:214653 19/88 (22%)
sdk2aXP_021327143.1 IGc2 66..124 CDD:197706
Ig 157..213 CDD:325142 10/44 (23%)
IGc2 259..313 CDD:197706 5/54 (9%)
Ig 352..420 CDD:319273 15/85 (18%)
Ig 442..518 CDD:325142 23/79 (29%)
I-set 523..612 CDD:333254 22/104 (21%)
FN3 616..706 CDD:238020 16/91 (18%)
fn3 719..805 CDD:306538 6/33 (18%)
FN3 820..916 CDD:238020
FN3 921..1009 CDD:238020
FN3 1019..1113 CDD:238020
FN3 1125..1220 CDD:238020
fn3 1229..1314 CDD:306538
FN3 1327..1420 CDD:238020
FN3 1437..1521 CDD:238020
FN3 1530..1642 CDD:238020
FN3 1652..1745 CDD:238020
FN3 1750..1838 CDD:238020
FN3 1871..1942 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.