DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and robo4

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio

Alignment Length:337 Identity:84/338 (25%)
Similarity:121/338 (36%) Gaps:78/338 (23%)


  Fly   175 HDRHRTWY---LHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGAN 236
            |.|||..:   .|.:..|.....|.:.:||..         .:|..|        |||:||.|:.
Zfish    40 HLRHRLMHQRASHRDRAHRRKGSRLVSEINLP---------RIVHHP--------SDVVVRVGSP 87

  Fly   237 ISLRCRASGSPRPIIKWKRD----DNSRIAINKNHIVNEWEGDTLEIT----RISRLDMGAYLCI 293
            .:|.|||.|:|.|.|:|.|:    |..::......||.. :|.....:    |..:.....|.||
Zfish    88 ATLSCRAEGNPEPTIQWLRNGQPLDTDKMDAQSQPIVLP-DGSLFFFSVVPGRKGQSHEAVYACI 151

  Fly   294 ASNGVPPTVSKRIKVSV-----DFPPMLLIPHQLVGAPEGFNVTIECFTE-AHPTSLNYWTRGEG 352
            |.|.:....|:...:.:     ||    .:....|....|...||.|... .||.....| |.:|
Zfish   152 AHNSIGNATSRNASLHIAALREDF----RVQPSDVEVAIGEMATINCSPPVGHPEPNVTW-RKDG 211

  Fly   353 PIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDG-IIRLYVSYPPT- 415
            .:|:.|:::..|         ...||.|......|.|:|.|:|.|..|..:. ..||.|...|. 
Zfish   212 ILINSSNEHYTE---------LKGKLIIAPAQKNDSGVYSCIASNMIGVRESRAARLSVLAKPVL 267

  Fly   416 ------------------TASSGIYSTDTHWG-ENG--INNNYAYGGPDSTRSIY---AQDKNTR 456
                              ..:.|.......|. |.|  .|..|.. .||.:..|:   |||.. |
Zfish   268 LRKPEDVSVQLGESAQFFCEADGDPMPSIEWSREQGPLPNGRYLI-NPDHSLQIHYVTAQDMG-R 330

  Fly   457 YQSNL-NEIGLS 467
            |...: |::|:|
Zfish   331 YSCTVENKLGVS 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 10/44 (23%)
Ig 130..200 CDD:143165 7/28 (25%)
I-set 226..310 CDD:254352 27/92 (29%)
IGc2 233..298 CDD:197706 21/73 (29%)
Ig 313..410 CDD:299845 25/99 (25%)
IG_like 325..410 CDD:214653 24/87 (28%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 29/117 (25%)
I-set 71..168 CDD:254352 29/115 (25%)
I-set 175..261 CDD:254352 26/100 (26%)
Ig2_Robo 177..261 CDD:143201 25/94 (27%)
I-set 265..350 CDD:254352 18/81 (22%)
Ig 282..350 CDD:299845 17/64 (27%)
FN3 373..448 CDD:214495
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.