DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and si:dkeyp-75h12.2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_009301412.1 Gene:si:dkeyp-75h12.2 ZFINID:ZDB-GENE-030131-7512 Length:653 Species:Danio rerio

Alignment Length:145 Identity:32/146 (22%)
Similarity:58/146 (40%) Gaps:28/146 (19%)


  Fly   215 VVPPN-------IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWK---------RDDNSRIAI 263
            |:.||       :.|..||.|.:  :||..|.:..::|...|:....         .::||.|.|
Zfish   506 VLSPNKWRSTEELMDCTSSPDTL--DGAVDSTKQFSNGWSSPVSNGPPSLPPLLDLDNNNSTIPI 568

  Fly   264 NK--NHIVNEWEGDTLEITRISRLDMGAY--LCIASNGVPPTVSKRIK------VSVDFPPMLLI 318
            |:  ...||...|.|..:|...:.::.:.  .|:|....|...::|.:      ::.|.....|:
Zfish   569 NRPLGWGVNNSNGATTPLTPTEQDEVVSCPGCCLAGMSFPSICTRRARQNPYKNLNGDAAGKRLL 633

  Fly   319 PHQLVGAPEGFNVTI 333
            ...|..:|...|:|:
Zfish   634 CKALPPSPTEPNITL 648

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 1/1 (100%)
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 21/103 (20%)
IGc2 233..298 CDD:197706 17/78 (22%)
Ig 313..410 CDD:299845 5/22 (23%)
IG_like 325..410 CDD:214653 3/10 (30%)
si:dkeyp-75h12.2XP_009301412.1 PKc_like 54..302 CDD:328722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.