DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and lrit3a

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001122166.1 Gene:lrit3a ZFINID:ZDB-GENE-080723-63 Length:636 Species:Danio rerio

Alignment Length:674 Identity:130/675 (19%)
Similarity:201/675 (30%) Gaps:294/675 (44%)


  Fly    81 GTGSTVVGSNGVIVAGGGANVPTSNLNIVVEE-------PEFTEYIEN-----VTVPAGRNVKLG 133
            ||||..|..|...::....|||...:.:.||:       .|...|:..     :|..:..:|..|
Zfish    35 GTGSRSVLCNDPDMSDIPVNVPLDTVKLRVEKTAVRRVPTEAFYYLSELRYLWITYNSITSVDPG 99

  Fly   134 C-----------------------SVKNLGSYKVAWMHFEQSAILTVHNHVITRNP------RIS 169
            .                       |:|.:.|.|.          |.:||:.:|..|      .|:
Zfish   100 SFYNLKVLHELRLDGNMIATFPWESLKEMPSLKT----------LDLHNNRLTSVPVEAAPYLIN 154

  Fly   170 VTHDKHDRHRTWYLHIN-------------------------NVHE------EDRGRYM-CQINT 202
            :|          ||.|:                         |..:      :|...|. |:|:.
Zfish   155 IT----------YLDISSNKLTTLPSDLVDIWPPFSGIQPSANTSQKTVLGLQDNPWYCDCRISK 209

  Fly   203 VTAKTQFGYLNVVV---------PPNIDDSL----------------SSSDVIVREGANISLRCR 242
            :...::...:.||:         |.::...|                |::.:....|:|:.|||.
Zfish   210 LIELSKMAGIPVVLMDQVLTCSGPEHLSGVLFQRAELDQCVKPTVMTSATKITSPLGSNVLLRCD 274

  Fly   243 ASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGD-----TLEITRISRLDMGAYLCIASNGVPPTV 302
            |:|.|.|.:.|...|.|   :..|.:|.|..|:     .|.:..|...|.|.|.|.|.| |....
Zfish   275 ANGFPTPTLLWTTADGS---VVNNTVVQESPGEGVRWSILSLHSIVFKDAGDYRCKAKN-VAGNA 335

  Fly   303 SKRIKVSVD-------FPPMLLIPHQLVGAPEGFNVT------IECFTEAHP---------TSLN 345
            ...|.:|||       |||:     .:...||....|      :..||...|         |::.
Zfish   336 EAYITLSVDGVQPTTPFPPI-----NITKQPEDQPTTTFTPTKMPLFTSLSPITITTRPVMTTMP 395

  Fly   346 YWTRGEGPI-----------------IHDSHKYK-------------VEATV----------GLP 370
            ..|..:.||                 :..|...|             ||.|.          |||
Zfish   396 PLTTRKSPIPGGGVQRSPPAGDKPAKVQQSKNGKGSIKKSDIRDIEVVEETTETAVLLWSAEGLP 460

  Fly   371 AYKTHMKLTIINVSSGDDGIYKCVAKNPRGETD---GIIRLYVSY--PP-------TTASSG--- 420
               :...||::        .:...||:.:...|   |..:|.:.|  |.       .|.|||   
Zfish   461 ---SDTPLTVV--------YFPYDAKDDKETVDTEVGQGKLLLEYLMPNQVYTVCLVTKSSGKEQ 514

  Fly   421 --IYSTDTHWGENGIN--------------------------------NNYAYGGPDSTRSIYAQ 451
              .:||....||.|.|                                |:....|||...|   :
Zfish   515 CVDFSTLEIGGEEGQNKVLMIASAIACAIAVPLIVVLLYKILCLYCKGNSSRNNGPDEDLS---K 576

  Fly   452 DKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNPSMAIAWLFVVIATLL 516
            |...::::      |:.::..|:...|.|.|.....|::                       .:|
Zfish   577 DTYVKFET------LTMKQRTLNGQANDLWARRQTQESE-----------------------RML 612

  Fly   517 LTIRSAV--------GSSHSLSLC 532
            |..||::        .||.|..||
Zfish   613 LCSRSSIDSQMTYKSDSSRSEYLC 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/162 (15%)
Ig 130..200 CDD:143165 20/131 (15%)
I-set 226..310 CDD:254352 27/89 (30%)
IGc2 233..298 CDD:197706 24/70 (34%)
Ig 313..410 CDD:299845 27/155 (17%)
IG_like 325..410 CDD:214653 25/143 (17%)
lrit3aNP_001122166.1 LRR_8 81..141 CDD:290566 10/70 (14%)
leucine-rich repeat 83..106 CDD:275378 3/23 (13%)
LRR_4 107..145 CDD:289563 8/48 (17%)
leucine-rich repeat 107..130 CDD:275378 2/23 (9%)
LRR_8 129..>171 CDD:290566 12/62 (19%)
LRR_4 129..170 CDD:289563 12/61 (20%)
leucine-rich repeat 131..154 CDD:275378 7/33 (21%)
leucine-rich repeat 155..168 CDD:275378 4/23 (17%)
TPKR_C2 199..249 CDD:301599 7/50 (14%)
Ig 252..343 CDD:299845 28/95 (29%)
IG_like 261..343 CDD:214653 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.