DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and sdk1a

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_009297968.1 Gene:sdk1a ZFINID:ZDB-GENE-081104-374 Length:2245 Species:Danio rerio

Alignment Length:598 Identity:122/599 (20%)
Similarity:202/599 (34%) Gaps:148/599 (25%)


  Fly    12 LLVLAATAGDSTNKIILPQILNGGGGGGGVGTA-----------QGKHPSGSKT--VA------- 56
            |:||...|.|:....:  |.:|...|......:           :|.|.|.:..  ||       
Zfish   267 LVVLGTAASDAGRYYV--QAVNEKNGENKTSPSIYLNVAANKKYRGSHDSEAPADPVAPVIVIPP 329

  Fly    57 --TGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANV--------PTSN------ 105
              |.||.....|.........||...   |.|...|||.||.|..:.        |||.      
Zfish   330 RNTTVVAGISEATLECVANARPVEKL---SLVWRRNGVEVASGVGSFSRRLTIINPTSTDVGMYV 391

  Fly   106 ------------------LNIVVEEPEFT-EYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQ 151
                              |:| .|.|.|| |....:.....::|.:.|..:.:...|:.|  ::.
Zfish   392 CEALLLDSSVKPAEARAFLSI-TEAPYFTAEPRRKMMGEVEKSVDIQCQARGVPMPKLEW--YKD 453

  Fly   152 SAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQ-FGYLNV- 214
            :..|:..|     |||..:.       .:..|.:..:...|.|.:.|.......:.| ..||:| 
Zfish   454 AVPLSKLN-----NPRYKII-------SSMGLQVRKLQPSDAGIFQCFARNSAGEAQVHTYLDVT 506

  Fly   215 ------VVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDD----NSRIAINKNHIV 269
                  ..||        .|:.|.:||..:..||.||:|:|.|.|:||.    :..:.|.:..::
Zfish   507 SMAPAFTAPP--------LDITVTDGAVAAFTCRVSGAPKPAIVWRRDTQILASGSVQIPRFTLL 563

  Fly   270 NEWEGDTLEITRISRLDMGAYLCIASN---GVPPTVSKRI--KVSVDFPPMLLIPHQLVGAPEGF 329
               |...|:|..:...|.|.|.|.|:|   .:..:.|..:  :.|:..||   ...:::   :|.
Zfish   564 ---ESGGLQIQPVVLQDTGNYTCYAANSEGAINASASLTVWSRTSISSPP---TDRRVI---KGT 619

  Fly   330 NVTIECFTEAHP-TSLNY-WTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYK 392
            ...:||.....| ..:.| |.:.|..:.| |...::....|        .|.|....|||.|.|.
Zfish   620 TAILECGATHDPRVGVRYVWKKDEELVSH-SRGGRISLQEG--------SLHISQTWSGDIGNYT 675

  Fly   393 CVAKNPRGETDGIIRLYV---SYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKN 454
            |...:..|......||.|   .:.|....:.:.:.|:...:......:....|.....:...:.|
Zfish   676 CDVISEAGNESKEARLEVIELPHSPRNLQASLNANDSRSVDLSWMRPFDGNSPLLHYVVELSENN 740

  Fly   455 TRYQSNLNEI----------GLSEQKSF--------------LDKTQNPLLANGNANEADAESNG 495
            :.::..|:::          ||:..:|:              .....|.|:.......|..::..
Zfish   741 SPWRVYLSDVDPSGTGAMVKGLTPARSYQFRVCAVNQVGRGQYSTETNRLMLREEPPSAPPKNIV 805

  Fly   496 ARGH-NPSMAIAW 507
            |.|. |.|:.:.|
Zfish   806 ASGRTNQSIMVQW 818

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 17/104 (16%)
Ig 130..200 CDD:143165 13/70 (19%)
I-set 226..310 CDD:254352 26/93 (28%)
IGc2 233..298 CDD:197706 22/72 (31%)
Ig 313..410 CDD:299845 23/99 (23%)
IG_like 325..410 CDD:214653 21/87 (24%)
sdk1aXP_009297968.1 I-set 125..208 CDD:254352
Ig 125..204 CDD:299845
IG_like 222..302 CDD:214653 8/37 (22%)
Ig 236..287 CDD:299845 7/22 (32%)
Ig_3 322..394 CDD:290638 18/75 (24%)
I-set 323..412 CDD:254352 18/92 (20%)
I-set 416..505 CDD:254352 20/103 (19%)
Ig 436..500 CDD:299845 13/78 (17%)
I-set 510..600 CDD:254352 27/101 (27%)
Ig 527..600 CDD:299845 21/76 (28%)
I-set 605..693 CDD:254352 24/103 (23%)
Ig 610..693 CDD:299845 22/98 (22%)
FN3 697..788 CDD:238020 8/91 (9%)
fn3 800..886 CDD:278470 5/20 (25%)
FN3 901..997 CDD:238020
FN3 1002..1090 CDD:238020
FN3 1100..1196 CDD:238020
FN3 1206..1301 CDD:238020
FN3 1308..1397 CDD:238020
FN3 1408..1501 CDD:238020
FN3 1507..1602 CDD:238020
FN3 1616..1722 CDD:238020
FN3 1732..1825 CDD:238020
FN3 1830..1919 CDD:238020
FN3 1931..2021 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.