DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and olfml2ba

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001038314.1 Gene:olfml2ba ZFINID:ZDB-GENE-041014-329 Length:883 Species:Danio rerio

Alignment Length:307 Identity:63/308 (20%)
Similarity:109/308 (35%) Gaps:80/308 (26%)


  Fly   244 SGSPRPIIKWK---RDDNSRIAI---NKNHIVNEWEGDTLEITRISR-LDMGAYLCIASNGVPPT 301
            |.:|:..::.:   :|:|..:.:   |:.||:::..||..::..:|. .|.|. .|:. ..:..:
Zfish    18 SAAPKSHLRLEEKTKDNNDTLQVEIDNQEHILSQLLGDYDKVKALSEGSDCGC-KCVV-RPLSAS 80

  Fly   302 VSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEAT 366
            ..:||:.....|........:...|.     .:|...|.|::||       |...|....|:.  
Zfish    81 ACQRIREGHATPQDFYTVETITSGPH-----CKCACIAPPSALN-------PCEGDFRLKKLR-- 131

  Fly   367 VGLPAYKTHMKL-TIINVSSGD--------------------DGIYKCVAKNPRGETDGIIRLYV 410
               .|.|.::|| ||:.:..|.                    |.|.|.|..|   :|:..:....
Zfish   132 ---QAGKDNIKLSTILELLEGSFYGMDLLKLHSVTTKILDRMDTIEKMVLNN---QTEEKLNTIS 190

  Fly   411 SYP--------PTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQ--------- 458
            :.|        |||..|.|....|...|.  |:..|........|:....:.::|:         
Zfish   191 TSPNPQLSTSSPTTLPSVIQEKRTSLREQ--NDEAAAFQHMEYYSVLKCTQQSKYEEKFVGDILN 253

  Fly   459 --SNLNE--IGLSEQKSFLDKTQNPLLANG-------NANEADAESN 494
              |:||:  ..|.||:....|.|..:...|       ..:|.|:|.|
Zfish   254 SGSDLNKATTALQEQEQQGRKKQPKITVRGITYYRSDPVDEMDSEKN 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 15/73 (21%)
IGc2 233..298 CDD:197706 13/61 (21%)
Ig 313..410 CDD:299845 23/118 (19%)
IG_like 325..410 CDD:214653 22/106 (21%)
olfml2baNP_001038314.1 PHA03255 450..>584 CDD:165513
OLF 625..875 CDD:280371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T597867
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.