DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and igsf9a

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_005155702.1 Gene:igsf9a ZFINID:ZDB-GENE-060503-288 Length:1619 Species:Danio rerio

Alignment Length:300 Identity:77/300 (26%)
Similarity:127/300 (42%) Gaps:44/300 (15%)


  Fly   120 ENVTVPAGRNVKLGCSV------KNLGSYKVAWMH--FEQSAILTVHNHVITRNPRISVTHDKHD 176
            |:|......:..|.||:      .:...|.:.|:.  |:....:.:..|     ||:   |..:|
Zfish    27 EHVRAKKDSSAVLPCSLPAPQKDSSASQYVIEWVRQGFDTPIFMQLGVH-----PRV---HPDYD 83

  Fly   177 RHRTWY----LHINNVHEEDRGRYMCQINTVTAKTQ-------FGYLNVVVPPNIDDSLSSSDVI 230
            ...:.:    |.::.:..||.|.|.|:|..:...|:       :..|:|..||.:.:: |..:|.
Zfish    84 GRVSLFGGTSLQMSGLQLEDEGWYECRILPLDQTTEEAGSSGSWTRLSVTAPPVLTET-SPPEVE 147

  Fly   231 VREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIAS 295
            |..|.:::|:|.|.|:|||.|.|.:|.   ..|...|.|....| ::....:||...|.|.|..|
Zfish   148 VFVGRSLTLKCAAQGNPRPTITWSKDG---APIKPQHKVKMVNG-SVSFHAVSREAAGQYQCYTS 208

  Fly   296 NGV-PPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY-WTRGEGPIIH-D 357
            |.. ..|...|:|:.  .||:::||..........:..::|..||.|.::.| |.|....|.| |
Zfish   209 NSEGNATHVTRLKII--GPPVIIIPPSDTVLNMSQDAKLKCQAEADPPNMTYVWQRQGVDIYHID 271

  Fly   358 SHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKN 397
            |.|.:::..|       ...|.|..::..|.|.|.|:..|
Zfish   272 SLKSRIKVIV-------DGTLLISRLAPEDSGNYTCMPTN 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 23/115 (20%)
Ig 130..200 CDD:143165 17/82 (21%)
I-set 226..310 CDD:254352 27/85 (32%)
IGc2 233..298 CDD:197706 22/65 (34%)
Ig 313..410 CDD:299845 24/87 (28%)
IG_like 325..410 CDD:214653 20/75 (27%)
igsf9aXP_005155702.1 IG_like 27..110 CDD:214653 19/91 (21%)
Ig 35..111 CDD:299845 17/84 (20%)
I-set 140..221 CDD:254352 27/86 (31%)
IGc2 151..212 CDD:197706 22/65 (34%)
Ig 233..318 CDD:299845 20/79 (25%)
I-set 233..318 CDD:254352 20/79 (25%)
Ig <349..402 CDD:299845
IG_like 423..502 CDD:214653
Ig 435..498 CDD:143165
FN3 507..602 CDD:238020
fn3 614..696 CDD:278470
PHA02666 1105..>1312 CDD:222914
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.