DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and kirrel3l

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001092814.2 Gene:kirrel3l ZFINID:ZDB-GENE-070831-1 Length:755 Species:Danio rerio

Alignment Length:467 Identity:98/468 (21%)
Similarity:163/468 (35%) Gaps:115/468 (25%)


  Fly   106 LNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKN-------------LGSYK--VAWMHFEQSAIL 155
            |..|.:...|::..::..|.||::|.|.|.:..             ||..:  ..|:.:.     
Zfish    11 LGTVSQAAYFSQQPQDQVVVAGQSVTLPCVIVGYRGMVQWTKDGLALGGERDLPGWVRYS----- 70

  Fly   156 TVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNI 220
                  :..:| :|..|.         |.|::....|...|.||......::....|.|:|||: 
Zfish    71 ------LMGDP-LSGEHS---------LVIDSAELGDDAIYECQATQAGLRSHRAKLTVLVPPS- 118

  Fly   221 DDSLSSSDVIVREGANI--SLRCRASGS-PRPIIKWKRD-DNSRIAINKNHIVNEWEGDTLEITR 281
             |.:.....:||..|:.  :|.|||||: |...|.|.|| :..:.||....::.:.:.:    |.
Zfish   119 -DPIVEGGPVVRLKAHTPHNLTCRASGAKPAAEITWYRDGEIMQNAIYSKSLMEDGKRE----TA 178

  Fly   282 ISRLDM--------GAYLCIASNGVPPTVSK-RIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFT 337
            :|.|.|        ..|.|...|...|...: .:.::|..||.:.:..|.....||..|...|..
Zfish   179 VSMLPMVPEDSDSGRTYTCRVLNPAAPAGRQTSVTINVQHPPSVTLSVQPQTVMEGAKVLFICSA 243

  Fly   338 EAHPTSLNY-WTRGEGPI---------IHDSHKY-------KVEATVGL------------PAYK 373
            .|:|....| |::|..||         :...|.|       :|..:||.            |...
Zfish   244 SANPEITGYRWSKGGVPISEANGDSLEVTADHSYFTDPVSCEVSNSVGSTNVSTLVDVQFGPRLL 308

  Fly   374 THMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYA 438
            |..|..|:::  |.|..:.|              .:...||.|.:         |.:.|.|...:
Zfish   309 TEPKPQIVDI--GMDAAFTC--------------SWTGNPPLTLA---------WTKQGSNVVLS 348

  Fly   439 YGGPDSTRSIYAQDKNT-RYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNG-----AR 497
            .......:::...|..| ..::.:..||::|:...|.....|::......:|...|.|     ..
Zfish   349 NSNTLQLKAVTQDDTGTYTCKAIVPRIGVAERDVTLTVNGPPIITAEATQQAIKHSKGKLECLVG 413

  Fly   498 GHNPSMAIAWLF 509
            ...|...|.|.|
Zfish   414 SSPPPDKIVWTF 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/111 (18%)
Ig 130..200 CDD:143165 15/85 (18%)
I-set 226..310 CDD:254352 24/97 (25%)
IGc2 233..298 CDD:197706 21/77 (27%)
Ig 313..410 CDD:299845 26/126 (21%)
IG_like 325..410 CDD:214653 23/114 (20%)
kirrel3lNP_001092814.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.