DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and sdk1b

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_017211454.1 Gene:sdk1b ZFINID:ZDB-GENE-090311-17 Length:2292 Species:Danio rerio

Alignment Length:450 Identity:101/450 (22%)
Similarity:162/450 (36%) Gaps:93/450 (21%)


  Fly   109 VVEEPEFTEYIENVTV-PAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH 172
            |:|.|.||...:...: ...:||:|.|..|.:.:.|:.|  |:.:..|:..|     |.|..:|.
Zfish   457 VLESPHFTSKPKRYMIAEVEKNVELQCHAKGVPTPKLEW--FKDAIPLSTLN-----NSRYKLTT 514

  Fly   173 DKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVV---------PPNIDDSLSSSD 228
            .      :..|.:..:..:|.|.:.|.......:.| .:.|:|:         ||        ||
Zfish   515 S------SMVLQVRRIQPDDAGIFQCFAENTAGEIQ-AHTNLVITSMSPLFTTPP--------SD 564

  Fly   229 VIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEW---EGDTLEITRISRLDMGAY 290
            :.|.:|.:....|..||:|:|.|.|::  .|::..:.:.....:   |...|:|..|...|.|.|
Zfish   565 ITVTDGTSAVFTCDTSGAPKPAIVWRK--GSQVLASGSVQTPRFTLLESGGLQILPIMPSDAGNY 627

  Fly   291 LCIASN-------GVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHP-TSLNY- 346
            .|:|||       .|..||..|..:|.  ||    ..|.|  .:|....:.|.....| .::.| 
Zfish   628 TCLASNTEGLVNATVALTVLSRTFIST--PP----EDQRV--IKGTTAVLHCAATHDPRVTVRYS 684

  Fly   347 WTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYV- 410
            |.:|..|:         ..:.|.........|.|....|||.|.|.|...:|.|......||.| 
Zfish   685 WKKGTKPL---------SVSTGGRVSMKEGSLQISQTWSGDIGDYTCRVISPAGNDSKSARLEVI 740

  Fly   411 --SYPPTTASSGIYSTDTH-----WGENGINNN------YAYGGPDSTRSIYAQDKNTRYQSNLN 462
              .:.|......:..||:.     |......|:      ..:...:|...:|..|.:....| |.
Zfish   741 ELPHSPRNLQVALNETDSRTVLLSWVRPFDGNSPLLHYIIEFSENNSPWKVYMDDVSPTLAS-LL 804

  Fly   463 EIGLSEQKSF--------------LDKTQNPLLANGNANEADAESNGARGH-NPSMAIAW 507
            .|||:..:::              .....|.|:.......|..::..|.|. |.|:.:.|
Zfish   805 VIGLTPARTYQFRVCAVNQVGRGQYSAETNRLMLREEPPSAPPKNIVASGRTNQSIMVQW 864

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/97 (21%)
Ig 130..200 CDD:143165 16/70 (23%)
I-set 226..310 CDD:254352 28/94 (30%)
IGc2 233..298 CDD:197706 20/75 (27%)
Ig 313..410 CDD:299845 24/99 (24%)
IG_like 325..410 CDD:214653 20/87 (23%)
sdk1bXP_017211454.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.