DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and ptprq

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_021323628.1 Gene:ptprq ZFINID:ZDB-GENE-050419-183 Length:2896 Species:Danio rerio

Alignment Length:518 Identity:102/519 (20%)
Similarity:167/519 (32%) Gaps:199/519 (38%)


  Fly   120 ENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVI---------------------- 162
            :|:..|..||.:.              :.|...::.|:.:|..                      
Zfish   881 QNLISPLRRNARS--------------LDFTTESVFTLTSHETFSTLGRDFTNTDTEAPSALPLT 931

  Fly   163 -----TRNPRISVTHDKHDR-------------------------HRTWYLHINNVHEEDR--GR 195
                 |..|.::||||:.|.                         ..:..:..::.|...|  |.
Zfish   932 PSTPHTPPPWLTVTHDRTDASVQTQTDAVTEDLTTEHPPVTPGTDQSSVNISPSHPHRVTRSTGS 996

  Fly   196 YMCQINT---VTAKTQFGYLNVVVPPNIDDSLSSSDV--IVREGANISLRCRASGSPRPIIKWKR 255
            ...|..|   ::|.|..| :.::....:...|||..:  :||         |.|    |..::| 
Zfish   997 DSTQQETNPPISAATTVG-IEILPATEVSADLSSDQITHVVR---------RLS----PFTEYK- 1046

  Fly   256 DDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN-GVPPTV---------SKRIKVSV 310
                 .:::..:|:.  ||.:.|:|            :.:| .||.:|         |..|:||.
Zfish  1047 -----FSVSAKNIIG--EGPSTEVT------------VKTNEQVPSSVQNVSYQNLSSTSIRVSW 1092

  Fly   311 DFP--PMLLIPHQLVGAPEGF-NVTIECFTEAHPTSL-------NYWTR-------GEGPIIHDS 358
            :.|  |...|.|..|.|.... |..:...|:.....|       :|..|       ||.|:.::.
Zfish  1093 EPPLNPNGKITHYAVYAQNLLTNQELRQMTDTTTAVLTGLDKYSSYKVRVAASTAVGESPLTNED 1157

  Fly   359 HKYKV--EATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLY-VSYPPTTASSG 420
            :.|.|  |.....|.    ..|||:..:|..    ..::.:|..:.:||||:| :||...|.|:.
Zfish  1158 YIYVVTLEDVPDSPP----RGLTIVKTTSST----ATLSWSPPEKPNGIIRMYEISYTNGTYSNT 1214

  Fly   421 IYSTD-----------THW------------GENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLN 462
            :.||.           ||:            ||..........|.|...|       ..|..:..
Zfish  1215 VNSTSASATLRYLKPHTHYNVTVRAFTLLGHGEQISETLQMLSGEDVPGS-------PPYDLSYE 1272

  Fly   463 EIGLSEQKSFLDKTQNPLLANG----------NANEADAESNGARGHNPSMAIAWLFVVIATL 515
            .||.|   |.......||||||          ||.::..::.    |.|       ::|::.|
Zfish  1273 SIGSS---SVNVSWSPPLLANGVILFYNVEYWNATQSLNQTT----HMP-------YIVLSNL 1321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/153 (14%)
Ig 130..200 CDD:143165 14/124 (11%)
I-set 226..310 CDD:254352 20/96 (21%)
IGc2 233..298 CDD:197706 10/66 (15%)
Ig 313..410 CDD:299845 28/117 (24%)
IG_like 325..410 CDD:214653 23/103 (22%)
ptprqXP_021323628.1 fn3 209..278 CDD:306538
FN3 301..363 CDD:328772
FN3 382..470 CDD:238020
FN3 475..569 CDD:238020
FN3 723..808 CDD:238020
FN3 829..>864 CDD:238020
FN3 <1033..1067 CDD:238020 11/67 (16%)
FN3 1072..1161 CDD:238020 21/89 (24%)
fn3 1170..1241 CDD:306538 19/79 (24%)
fn3 1264..1340 CDD:306538 18/80 (23%)
fn3 1368..>1410 CDD:306538
FN3 1460..1549 CDD:238020
FN3 1585..1670 CDD:214495
FN3 1697..1768 CDD:238020
FN3 1781..1872 CDD:238020
fn3 1878..1958 CDD:306538
FN3 2029..2133 CDD:238020
FN3 2141..2235 CDD:238020
FN3 2242..2338 CDD:238020
UP_III_II 2354..>2491 CDD:297589
PTPc 2599..2855 CDD:214550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.