DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and lrit1a

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001018174.2 Gene:lrit1a ZFINID:ZDB-GENE-040924-5 Length:643 Species:Danio rerio

Alignment Length:345 Identity:69/346 (20%)
Similarity:117/346 (34%) Gaps:91/346 (26%)


  Fly   234 GANISLRCRASGSPRPIIKWKRDD----NSRIAI--NKNHIVNEWEGDTLEITRISRLDMGAYLC 292
            |.|:.|||...|.|.|.:.|:|.|    |..:.:  :|..||  |  ..|.:..:|..|.|.|:|
Zfish   266 GNNVLLRCGTVGVPIPELAWRRADGKPLNGTVLLENSKEGIV--W--SILSVPAVSYRDTGKYIC 326

  Fly   293 IASN--GVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPII 355
            .|:|  |....|...|               :..||:..|.|::...:......|       .::
Zfish   327 KATNYAGSAEAVISLI---------------I
NDAPKMENPTLDPKPKLKSKKPN-------TMV 369

  Fly   356 HDSHKYKVEATVGLPAYKTHMKLT-IINVSSGDDGIYKCVAKNPRGET-----DGIIRLYVSYPP 414
            ..:::.|..||...|..|..:.|: .::.:....|:....|.|.|..|     ||.:...:|...
Zfish   370 KAAYQEKHIATYVSPTPKNGLPLSGTVSYTGPYPGMESDNAANSRMNTQTASPDGFLETNLSNLA 434

  Fly   415 TTASS-----------------GIYSTDTHWGENGINNN------YAYGGPDSTRSIYAQDKNTR 456
            ...||                 ..|:...:|......|.      ||..|....|.|.....|.|
Zfish   435 ANTSSLQQDPDRVVRSVKVIGDTDYTVCLNWRAPTAKNTTAFSVLYAVFGERDMRRINVSPGNNR 499

  Fly   457 YQSNLNEIGLSEQ---------KSFLDKTQNPLLANGNANEADAESNGARGHNPSMAIAWLFVVI 512
            ....    ||..:         |..:.|.:..::.   :.:|.|.:||.:            .:|
Zfish   500 IVIE----GLVPKTKYIACVCVKGLIPKKEQCVIF---STDAAASANGTQ------------KLI 545

  Fly   513 ATLLLTIRSAVGSSHSLSLC 532
            ..:::|:...:....::.:|
Zfish   546 NVVVITVACVIAVPLTVIVC 565

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 27/84 (32%)
IGc2 233..298 CDD:197706 25/72 (35%)
Ig 313..410 CDD:299845 18/103 (17%)
IG_like 325..410 CDD:214653 18/91 (20%)
lrit1aNP_001018174.2 leucine-rich repeat 61..84 CDD:275378
LRR_8 63..119 CDD:290566
LRR_RI <77..175 CDD:238064
leucine-rich repeat 85..108 CDD:275378
LRR_8 108..167 CDD:290566
leucine-rich repeat 109..132 CDD:275378
leucine-rich repeat 133..156 CDD:275378
leucine-rich repeat 157..170 CDD:275378
LRRCT 199..243 CDD:214507
I-set 252..343 CDD:254352 27/96 (28%)
Ig 259..333 CDD:299845 24/71 (34%)
fn3 448..515 CDD:278470 12/71 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.