DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and lrit1b

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001036218.1 Gene:lrit1b ZFINID:ZDB-GENE-060616-45 Length:654 Species:Danio rerio

Alignment Length:352 Identity:73/353 (21%)
Similarity:129/353 (37%) Gaps:94/353 (27%)


  Fly   234 GANISLRCRASGSPRPIIKWKRDDNSRI------AINKNHIVNEWEGDTLEITRISRLDMGAYLC 292
            |.|:.|||...|.|.|.:.|.|.|...:      .::|..|:  |  ..|.:..:|..|.|.|:|
Zfish   266 GNNVLLRCGTIGVPIPELSWARADGKPMNGTVQQEVSKEGII--W--SILSVPAVSYRDSGKYVC 326

  Fly   293 IASN-----------------GVPPTVSKRI--KVSVDF--------------PPM------LLI 318
            .|:|                 .:...|:||.  |.|..|              ||.      ::.
Zfish   327 KATNFVGSADAIISLVI
SDTWQIDEAVAKRSHGKKSGGFGRAAYQEKLIARYVPPSTSAAVPIIE 391

  Fly   319 PHQLVGAPEG-FNVTIECFT-EAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTII 381
            |   :.:|:| .:|.||.:: .|..:.|....:...|.:..:....::..|        :.....
Zfish   392 P---LNSPQGSSSVQIESYSVSADASKLKPKPKPTAPPVGQTEPVALQRDV--------LNNLEP 445

  Fly   382 NVSSGDDGIYKCVAKNPR--GETDGIIRLYVSYPP---TTASSGIYSTDTHWGENGINNNYAYGG 441
            |.||...|..:.|.::.:  |:||..:.|....|.   ||:.|.:|:.   :||..:.....  |
Zfish   446 NASSLQQGPERRVVRSVKVIGDTDHTVSLNWRAPTATNTTSFSVLYAV---FGERDMRRINV--G 505

  Fly   442 PDSTR-SIYAQDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNPSMAI 505
            |...| :|......|:|.:.:...||..:|.     |..:.:...|    |.::|.:        
Zfish   506 PGKNRITIEGLVPKTKYIACVCVKGLIPKKE-----QCVIFSTDEA----ASASGTQ-------- 553

  Fly   506 AWLFVVIATLLLTIRSAVGSSHSLSLC 532
                .:|..:::|:...:....:|.:|
Zfish   554 ----KLINVVVITVACVIAVPLTLIVC 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 27/101 (27%)
IGc2 233..298 CDD:197706 22/87 (25%)
Ig 313..410 CDD:299845 21/107 (20%)
IG_like 325..410 CDD:214653 18/89 (20%)
lrit1bNP_001036218.1 LRR_RI <59..168 CDD:238064
leucine-rich repeat 64..84 CDD:275380
LRR_8 83..143 CDD:290566
leucine-rich repeat 85..108 CDD:275380
leucine-rich repeat 109..132 CDD:275380
LRR_8 131..>176 CDD:290566
LRR_4 131..172 CDD:289563
leucine-rich repeat 133..156 CDD:275380
leucine-rich repeat 157..175 CDD:275380
leucine-rich repeat 185..203 CDD:275378
LRRCT 199..243 CDD:214507
I-set 252..343 CDD:254352 22/81 (27%)
IGc2 265..333 CDD:197706 22/71 (31%)
FN3 459..526 CDD:214495 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.