DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and igsf9b

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_686205.6 Gene:igsf9b ZFINID:ZDB-GENE-060810-28 Length:2021 Species:Danio rerio

Alignment Length:496 Identity:104/497 (21%)
Similarity:182/497 (37%) Gaps:154/497 (31%)


  Fly   127 GRNVKLGCSV---------KNL-GSYKVAWMHFEQSAILTVHNHVITRNPRISVTH-DKHDRHRT 180
            |...:||||:         .|| ..:.|.|:....:..:.:.....|  ||:...: .:....|.
Zfish    35 GGFAELGCSLTPPSEGATTPNLFPLHVVEWVRLGYNVPILIKFGSYT--PRVHPNYKGRVSLSRG 97

  Fly   181 WYLHINNVHEEDRGRYMCQI---NTVTAKTQFG---YLNVVVPPNIDDSLSSSDVIVRE------ 233
            ..|.:..:..||.|.:.|:|   :..:.:.|.|   :|::..||          |.::.      
Zfish    98 ASLMVEKLTLEDEGWFECRILLLDRTSDEFQNGTW
NFLSITAPP----------VFIKTPPPFLE 152

  Fly   234 ---GANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIAS 295
               |.:::|.|.|.|:|:|.|.|::..::.....:..::||    ||.:::::|...|.|.|..|
Zfish   153 VLLGESLTLHCDAHGNPKPTIIWRKYLSAAEKQEEIQVLNE----TLSLSKVTRETAGIYKCHVS 213

  Fly   296 NGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPE------GFNVTIECFTEAHPTSLNY--WTRGEG 352
            |. ...::...::.|..||:::|      |||      ..:..::|..||:|::|.|  |.:|:.
Zfish   214 NS-EGNLTHSTQLQV
KGPPIIII------APEDTTMNMSQDAVLQCQAEAYPSNLTYEWWKQGQN 271

  Fly   353 ----PIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYP 413
                .|:....|..|:.|           |.|..:...|.|.|.|   .|   |:|::.     |
Zfish   272 VYHIEILKSRVKILVDGT-----------LLISALIPDDSGNYTC---RP---TNGLMT-----P 314

  Fly   414 PTTASSGIYSTDTH-----------------------------------WGENGINNNY-AYGG- 441
            |..::   |.|..|                                   |.::|.:.|. .|.| 
Zfish   315 PAASA---YLTVKHPARVVRMPRETYLPMGMGGKIPCPVQAEPPMLYVNWTKDGASLNLEQYPGW 376

  Fly   442 -PDSTRSIYAQDKN---------TRY-------QSNLNEIGLSEQKSFLDKTQNPLLAN-GNANE 488
             .:|..|::....|         |.|       ||...::.|.:..||....:...|.. |....
Zfish   377 MVNSEGSVFITAANDDAVGMYTCTAYNSYGTMGQSEPTKVILKDPPSFRVSPRAEYLQEVGRDLV 441

  Fly   489 ADAESNGARGHNPSMAIAWL---------FVVIATLLLTIR 520
            ...:|.|    :||..|.|:         |.|::...|.:|
Zfish   442 IPCQSQG----DPSPNITWIKVGPAPRSPFTVLSNGSLFLR 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/106 (21%)
Ig 130..200 CDD:143165 17/81 (21%)
I-set 226..310 CDD:254352 20/93 (22%)
IGc2 233..298 CDD:197706 19/74 (26%)
Ig 313..410 CDD:299845 27/109 (25%)
IG_like 325..410 CDD:214653 24/97 (25%)
igsf9bXP_686205.6 Ig 27..132 CDD:299845 21/99 (21%)
IG_like 148..227 CDD:214653 19/84 (23%)
IGc2 156..217 CDD:197706 19/66 (29%)
Ig 237..323 CDD:299845 27/111 (24%)
IG_like 237..323 CDD:214653 27/111 (24%)
Ig 345..411 CDD:143165 11/66 (17%)
IG_like 435..507 CDD:214653 11/49 (22%)
IGc2 437..496 CDD:197706 11/47 (23%)
FN3 512..603 CDD:238020
FN3 621..709 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.