DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and KIRREL1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 HGNCID:15734 Length:773 Species:Homo sapiens

Alignment Length:564 Identity:111/565 (20%)
Similarity:187/565 (33%) Gaps:178/565 (32%)


  Fly   112 EPEFTEYIENVTVPAGRNVKLGCSVKN---------------LGSYKVAWMHFEQSAILTVHNHV 161
            :..|::...:.||.||:...|.|.:.|               :|....||               
Human    20 QTRFSQEPADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAW--------------- 69

  Fly   162 ITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSS 226
                ||..|........  :.|.|.:....|...|.||......:::...|.|::||. |..:..
Human    70 ----PRYRVVGSADAGQ--YNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPE-DTRIDG 127

  Fly   227 SDVI-VREGANISLRCRA-SGSPRPIIKWKRDDNSRI-AINKNHIVNEWEGDTLEITRI----SR 284
            ..|| ::.|...:|.||| :..|...|.|.||...:. |:....::.:.:.:| .::::    :.
Human   128 GPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRET-TVSQLLINPTD 191

  Fly   285 LDMG-AYLCIASN-GVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY- 346
            ||:| .:.|.:.| .:|......|::.|..||.:.:..:.....||..|...|...|:|..|.| 
Human   192 LDIGRVFTCRSMNEAIPSGKETSIELDVHHPPTVTLSIEPQTVQEGERVVFTCQATANPEILGYR 256

  Fly   347 WTRGEGPIIHDSHKYKVEATVGLPAY------KTHMKL------TIIN----------------- 382
            |.:| |.:|.|:|:.:.|..|....:      :.|.|:      |::|                 
Human   257 WAKG-GFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTD 320

  Fly   383 --------------------------------------------------------VSSGDDGIY 391
                                                                    |:..|.|.|
Human   321 IGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALSAQVLSNSNQLLLKSVTQADAGTY 385

  Fly   392 KCVAKNPR-GETDGIIRLYVSYPPTTASSGI-YSTDTHWGENGINNNYAYGGPDSTRSIYAQDKN 454
            .|.|..|| |..:..:.|||:.||..:|..: |:..   |:.|....:....|...|..:|    
Human   386 TCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVR---GDGGKVECFIGSTPPPDRIAWA---- 443

  Fly   455 TRYQSNLNEIGLSEQKSFLDKTQN-----PLLANGNANEADAESN----GARGHNPSMAIAWL-- 508
              ::.|..|:|..|:.: :::|.:     ..|...|..|||.:::    ......|..||..|  
Human   444 --WKENFLEVGTLERYT-VERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEE 505

  Fly   509 ---------------------FVVIATLLLTIRSAVGSSHSLSL 531
                                 |..||.:....|...||...::|
Human   506 REVLPVGIIAGATIGASILLIFFFIALVFFLYRRRKGSRKDVTL 549

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 21/111 (19%)
Ig 130..200 CDD:143165 15/85 (18%)
I-set 226..310 CDD:254352 21/93 (23%)
IGc2 233..298 CDD:197706 17/73 (23%)
Ig 313..410 CDD:299845 33/184 (18%)
IG_like 325..410 CDD:214653 31/172 (18%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 21/115 (18%)
Ig 25..116 CDD:299845 20/112 (18%)
Ig2_KIRREL3-like 138..219 CDD:143236 18/82 (22%)
I-set 223..304 CDD:254352 21/82 (26%)
Ig_2 227..305 CDD:290606 20/79 (25%)
Ig_2 311..405 CDD:290606 11/94 (12%)
IG_like 314..405 CDD:214653 11/91 (12%)
Ig5_KIRREL3 407..504 CDD:143306 23/107 (21%)
IG_like 416..504 CDD:214653 20/98 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.