DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and zgc:110372

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:zgc:110372 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio

Alignment Length:302 Identity:89/303 (29%)
Similarity:141/303 (47%) Gaps:36/303 (12%)


  Fly   114 EFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRH 178
            ||....:|:||..|.:|.|.|.:....::| ||::  :|.||.......:.:.|:|:   :::.:
Zfish    28 EFGHLPDNITVLEGESVVLRCKIDEEVTHK-AWLN--RSNILFTGTDKWSLDSRVSL---ENNNN 86

  Fly   179 RTWYLHINNVHEEDRGRYMCQINTVT-AKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCR 242
            ..:.:.|..|...|.|.|.|...... .:|...||.|.||..|.:  .|.|..|.||.:::|.|.
Zfish    87 SDFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVN--ISQDKSVNEGEDVNLFCL 149

  Fly   243 ASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIK 307
            |.|.|.|.|.||.        .|..::|  ||:.||||.|.|.....:.||.:|||.|..::::|
Zfish   150 AVGRPEPTITWKD--------FKYGLLN--EGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVK 204

  Fly   308 VSVDFPPMLL----IPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGE-GPIIHDSHKYKVEATV 367
            |:|::||::.    :|.|:     |....:.|...|.||:...|.|.: .|:..|:       |:
Zfish   205 VTVNYPPIITDVKNMPAQV-----GKTAILRCEAMAVPTASFEWYRDDRRPVESDN-------TL 257

  Fly   368 GLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLY 409
            .:...||...|...||:....|.|.|.|.|..|.::..:.|:
Zfish   258 KIKNEKTRSLLLFTNVTEKHFGNYTCFASNRLGASNASMLLF 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 25/97 (26%)
Ig 130..200 CDD:143165 17/70 (24%)
I-set 226..310 CDD:254352 32/84 (38%)
IGc2 233..298 CDD:197706 25/65 (38%)
Ig 313..410 CDD:299845 26/103 (25%)
IG_like 325..410 CDD:214653 22/87 (25%)
zgc:110372NP_001017775.2 IG_like 33..123 CDD:214653 24/96 (25%)
Ig 35..123 CDD:299845 24/94 (26%)
Ig 125..>183 CDD:299845 27/70 (39%)
I-set 128..207 CDD:254352 33/91 (36%)
IG_like 217..298 CDD:214653 23/93 (25%)
ig 223..296 CDD:278476 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80552569
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.636 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.