DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and SDK2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001138424.1 Gene:SDK2 HGNCID:19308 Length:2172 Species:Homo sapiens

Alignment Length:503 Identity:109/504 (22%)
Similarity:187/504 (37%) Gaps:139/504 (28%)


  Fly     2 LPPSWH----LIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPN 62
            :|||..    |...|::|:..|.|:....:  |.:|...|..  .|:|         ..|..|.|
Human   154 IPPSSRIAITLENTLVILSTVAPDAGRYYV--QAVNDKNGDN--KTSQ---------PITLTVEN 205

  Fly    63 FGGAAGNGAGGGGPVAGS-----GTGSTVVGS-----------------------NGVIVAGG-- 97
            .||.|       .|:|.:     ...|.|.|:                       :||:::||  
Human   206 VGGPA-------DPIAPTIIIPPKNTSVVAGTSEVTLECVANARPLIKLHIIWKKDGVLLSGGIS 263

  Fly    98 --------------------------GANVPT----SNLNIVVEEPEFTEYIE-NVTVPAGRNVK 131
                                      .::||:    :.|: |:|.|:|.:..| ::|....:.|.
Human   264 DHNRRLTIPNPTGSDAGYYECEAVLRSSSVPSVVRGAYLS-VLEPPQFVKEPERHITAEMEKVVD 327

  Fly   132 LGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRY 196
            :.|..|.:....:.|  ::.:|::.|..  :||      ...::|..    |.|:.:..:|.|.:
Human   328 IPCQAKGVPPPSITW--YKDAAVVEVEK--LTR------FRQRNDGG----LQISGLVPDDTGMF 378

  Fly   197 MCQINTVTAKTQFG-YLNVV-VPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNS 259
            .|.......:.|.. ||.|. :.|||......|.||  :|.::.|.|..||:|||.|.|::.:  
Human   379 QCFARNAAGEVQTSTYLAVTSIAPNITRGPLDSTVI--DGMSVVLACETSGAPRPAITWQKGE-- 439

  Fly   260 RIAINKNHIVNEW---EGDTLEITRISRLDMGAYLCIASN--GVPPTVSKRI---KVSVDFPPML 316
            ||..:.:..:..:   |..:|.|:.....|.|.|.|:|:|  ||....:..:   :..:..||  
Human   440 RILASGSVQLPRFTPLESGSLLISPTHISDAGTYTCLATNSRGVDEASADLVVWARTRITKPP-- 502

  Fly   317 LIPHQLVGAPEGFNVTIECFTEAHP-TSLNY-WTRGEGPIIHDSH-KYKVEATVGLPAYKTHMKL 378
                |.....:|...::.|.....| .::.| |.:....:..:|| :.:::....|     |:..
Human   503 ----QDQSVIKGTQASMVCGVTHDPRVTIRYIWEKDGATLGTESHPRIRLDRNGSL-----HISQ 558

  Fly   379 TIINVSSGDDGIYKCVAKNPRGETDGIIRLYV-------SYPPTTASS 419
            |    .|||.|.|.|...:..|.......|.|       .:|..|.|:
Human   559 T----WSGDIGTYTCRVISAGGNDSRSAHLRVRQLPHAPEHPVATLST 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/99 (20%)
Ig 130..200 CDD:143165 14/70 (20%)
I-set 226..310 CDD:254352 26/92 (28%)
IGc2 233..298 CDD:197706 22/70 (31%)
Ig 313..410 CDD:299845 21/100 (21%)
IG_like 325..410 CDD:214653 18/88 (20%)
SDK2NP_001138424.1 Ig 27..109 CDD:299845
IG_like 40..109 CDD:214653
I-set 120..203 CDD:254352 14/62 (23%)
Ig 132..210 CDD:299845 18/69 (26%)
IG_like 222..304 CDD:214653 10/83 (12%)
IGc2 233..286 CDD:197706 4/53 (8%)
I-set 308..397 CDD:254352 21/103 (20%)
Ig 326..394 CDD:143165 15/82 (18%)
I-set 402..492 CDD:254352 29/94 (31%)
Ig 416..492 CDD:299845 23/78 (29%)
Ig 502..586 CDD:299845 20/99 (20%)
IG_like 502..586 CDD:214653 20/99 (20%)
FN3 590..681 CDD:238020 3/14 (21%)
FN3 693..786 CDD:238020
FN3 794..890 CDD:238020
FN3 895..983 CDD:238020
FN3 993..1087 CDD:238020
FN3 1099..1194 CDD:238020
FN3 1201..1290 CDD:238020
FN3 1301..1394 CDD:238020
FN3 1400..1484 CDD:238020
FN3 1503..1616 CDD:238020
FN3 1626..1719 CDD:238020
FN3 1724..1805 CDD:238020
FN3 1837..1916 CDD:238020
PDZ-binding. {ECO:0000250|UniProtKB:Q6V4S5} 2166..2172
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.