DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Cntn3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_008761419.1 Gene:Cntn3 RGDID:3253 Length:1047 Species:Rattus norvegicus

Alignment Length:379 Identity:98/380 (26%)
Similarity:149/380 (39%) Gaps:81/380 (21%)


  Fly    49 PS--GSKT-VATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVV 110
            ||  |:.| |.|..|.|            ..|.||.| ..|:.|:||:    |...|    .|.:
  Rat   188 PSDVGNYTCVVTSTVTN------------ARVLGSPT-PLVLRSDGVM----GEYEP----KIEL 231

  Fly   111 EEPEFTEYIENVTVPA--GRNVKLGCSVKNLGSYKVAW-----MHFEQSAILTVHNHVITRNPRI 168
            :.||        |:||  |..|||.|........::.|     |.|.....|...|.|       
  Rat   232 QFPE--------TLPAAKGSTVKLECFALGNPVPQINWRRSDGMPFPTKIKLRKFNGV------- 281

  Fly   169 SVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAK-TQFGYLNVVVPPNIDDSLSSSDVIVR 232
                          |.|.|..:||.|.|.|.......| ...|.|.....|.....|...:..|.
  Rat   282 --------------LEIPNFQQEDTGSYECIAENSRGKNVARGRLTYYAKPYWVQLLKDVETAVE 332

  Fly   233 EGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN- 296
            :  ::...|||||.|:|..:|.::.::.:...:..|    |...|.|..::..|.|.:.|||.| 
  Rat   333 D--SLYWECRASGKPKPSYRWLKNGDALVLEERIQI----ENGALTIANLNVSDSGMFQCIAENK 391

  Fly   297 -GVPPTVSKRIKVSVDFPPMLLIP-HQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSH 359
             |:..: |..:||....|.....| .:::....|..|.::|...|.|.:|::|.:|: .::.:..
  Rat   392 HGLIYS-SAELKVLASAPDFSRNPMKKMIQVQVGSLVILDCKPSASPRALSFWKKGD-TVVREQA 454

  Fly   360 KYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYP 413
            :..:....|         |.|:||:..|.|||.|:|:|..|:.:|..:|.|:.|
  Rat   455 RISLLNDGG---------LKIMNVTKADAGIYTCIAENQFGKANGTTQLVVTEP 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 25/104 (24%)
Ig 130..200 CDD:143165 18/75 (24%)
I-set 226..310 CDD:254352 23/86 (27%)
IGc2 233..298 CDD:197706 19/67 (28%)
Ig 313..410 CDD:299845 25/98 (26%)
IG_like 325..410 CDD:214653 23/85 (27%)
Cntn3XP_008761419.1 Ig 25..114 CDD:299845
I-set 26..117 CDD:254352
Ig 120..214 CDD:299845 12/39 (31%)
IG_like 130..205 CDD:214653 8/29 (28%)
Ig 227..315 CDD:299845 29/121 (24%)
IG_like 234..313 CDD:214653 27/108 (25%)
I-set 318..403 CDD:254352 24/92 (26%)
Ig 320..403 CDD:299845 23/90 (26%)
I-set 408..496 CDD:254352 25/98 (26%)
Ig 424..496 CDD:299845 23/82 (28%)
IG_like 506..594 CDD:214653
Ig 515..598 CDD:299845
FN3 598..695 CDD:238020
FN3 703..795 CDD:238020
FN3 805..898 CDD:238020
FN3 906..991 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.