DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and cntn1b

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001014814.1 Gene:cntn1b ZFINID:ZDB-GENE-041210-236 Length:1031 Species:Danio rerio

Alignment Length:389 Identity:93/390 (24%)
Similarity:152/390 (39%) Gaps:89/390 (23%)


  Fly   183 LHINNVHEEDRGRYMCQINTVTAKTQFGY---LNVVVPPNIDDSLSSSDVIVREGANISLRCRAS 244
            ||:.||..||.|.|.|:  |:..|....|   |.|..||...:.::.::..|  |:.::|||.|.
Zfish   299 LHLINVQYEDEGSYECE--TLNVKGMDWYRQWLYVE
GPPEWAEHINDTEKDV--GSELTLRCVAV 359

  Fly   245 GSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN--GVPPTV--SKR 305
            |.|.|.|:|.:|..|            :....|:.:.::..|.|.|.|||.|  |   |:  :..
Zfish   360 GKPIPWIRWLKDGYS------------YGKGELKFSSLTFEDSGMYQCIAENEWG---TIYANAE 409

  Fly   306 IKVSVDFPPMLLIPHQ--LVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVG 368
            ::|....|..:..|.:  |:||..| .|.|||...|.|.....|.||...:.:.|..:..:    
Zfish   410 LRV
VSCAPTFIYNPVKKILLGAENG-RVVIECNPRAAPKPRFIWKRGSELLSNSSRIFIWD---- 469

  Fly   369 LPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDG---------------------------II 406
                  ...|.|:|.:..|:|.|.|.|:|.||:::.                           ::
Zfish   470 ------DGSLEILNATKSDEGSYTCYAENDRGKSNSTGTLTITEATKITVGPSNSEAAVGDTIVL 528

  Fly   407 RLYVSYPPTTASSGIYSTDTHWGENGIN--NNYAYGGPDSTRSIYAQDKNTRYQSNL--NEIGLS 467
            :...||.|:...:.|::.|::    .||  .::.:         |..|.:.....:|  ..|.:.
Zfish   529 QCSASYDPSLDVTFIWTVDSY----SINFYTDFEH---------YELDMDHENSGDLLIKNIQIR 580

  Fly   468 EQKSFLDKTQNPLLANGNANEADAESNGARGHNPSMAIAWLFVVIATLLLTIRSAVGSSHSLSL 531
            ....::...|. ::.|..| |||....|..|....:.:.    .|....:.||..:||.|...|
Zfish   581 HAGHYICTAQT-IVDNATA-EADVFVRGLPGPPGGVRVE----EIGDTSVKIRWCLGSDHGSPL 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 14/36 (39%)
Ig 130..200 CDD:143165 9/17 (53%)
I-set 226..310 CDD:254352 24/88 (27%)
IGc2 233..298 CDD:197706 21/67 (31%)
Ig 313..410 CDD:299845 27/126 (21%)
IG_like 325..410 CDD:214653 23/112 (21%)
cntn1bNP_001014814.1 Ig 41..133 CDD:299845
I-set 42..135 CDD:254352
Ig 138..234 CDD:299845
IG_like 148..219 CDD:214653
Ig 245..332 CDD:299845 14/35 (40%)
IG_like 253..331 CDD:214653 13/34 (38%)
Ig 336..412 CDD:299845 23/93 (25%)
IG_like 343..412 CDD:214653 23/86 (27%)
IG_like 428..505 CDD:214653 25/88 (28%)
Ig5_Contactin_like 434..505 CDD:143170 22/82 (27%)
IG_like 515..604 CDD:214653 17/104 (16%)
Ig 524..608 CDD:299845 18/99 (18%)
FN3 608..708 CDD:238020 8/36 (22%)
FN3 716..808 CDD:238020
fn3 817..903 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.