DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Ntm

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_008764287.1 Gene:Ntm RGDID:620958 Length:367 Species:Rattus norvegicus

Alignment Length:329 Identity:104/330 (32%)
Similarity:155/330 (47%) Gaps:37/330 (11%)


  Fly    91 GVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAIL 155
            ||.|..|.|..|.:              ::||||..|.:..|.|::.|..: :|||::  :|.||
  Rat    28 GVPVRSGDATFPKA--------------MDNVTVRQGESATLRCTIDNRVT-RVAWLN--RSTIL 75

  Fly   156 TVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVT-AKTQFGYLNVVVPPN 219
            ...|.....:||:.:..:...::.   :.|.||...|.|.|.|.:.|.. .||...:|.|.|.|.
  Rat    76 YAGNDKWCLDPRVVLLSNTQTQYS---IEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPK 137

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISR 284
            |.:  .|||:.:.||.||||.|.|:|.|.|.:.|:.       |:...:....|.:.|||..|:|
  Rat   138 IVE--ISSDISINEGNNISLTCIATGRPEPTVTWRH-------ISPKAVGFVSEDEYLEIQGITR 193

  Fly   285 LDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTR 349
            ...|.|.|.|||.|...|.:|:||:|::|| .:...:..|.|.|...|::|...|.|::...|.:
  Rat   194 EQSGEYECSASNDVAAPVVRRVKVTVNYPP-YISEAKGTGVPVGQKGTLQCEASAVPSAEFQWFK 257

  Fly   350 GEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP 414
            .:..::......|||....|      .:||..|||..|.|.|.|||.|..|.|:..|.|:....|
  Rat   258 DDKRLVEGKKGVKVENRPFL------SRLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEP 316

  Fly   415 TTAS 418
            |:::
  Rat   317 TSST 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/97 (30%)
Ig 130..200 CDD:143165 19/70 (27%)
I-set 226..310 CDD:254352 33/84 (39%)
IGc2 233..298 CDD:197706 25/65 (38%)
Ig 313..410 CDD:299845 30/97 (31%)
IG_like 325..410 CDD:214653 27/85 (32%)
NtmXP_008764287.1 Ig 44..132 CDD:299845 28/94 (30%)
IG_like 44..132 CDD:214653 28/94 (30%)
IG_like 142..219 CDD:214653 33/84 (39%)
IGc2 149..205 CDD:197706 24/63 (38%)
ig 226..308 CDD:278476 26/88 (30%)
IG_like 233..310 CDD:214653 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80529853
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 1 1.000 H41139
Inparanoid 1 1.050 129 1.000 Inparanoid score I4484
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T131101
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.