DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and NTM

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_016873341.1 Gene:NTM HGNCID:17941 Length:385 Species:Homo sapiens

Alignment Length:329 Identity:105/330 (32%)
Similarity:154/330 (47%) Gaps:37/330 (11%)


  Fly    91 GVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAIL 155
            ||.|..|.|..|.:              ::||||..|.:..|.|::.|..: :|||::  :|.||
Human    28 GVPVRSGDATFPKA--------------MDNVTVRQGESATLRCTIDNRVT-RVAWLN--RSTIL 75

  Fly   156 TVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVT-AKTQFGYLNVVVPPN 219
            ...|.....:||:.:..:...::.   :.|.||...|.|.|.|.:.|.. .||...:|.|.|.|.
Human    76 YAGNDKWCLDPRVVLLSNTQTQYS---IEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPK 137

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISR 284
            |.:  .|||:.:.||.||||.|.|:|.|.|.:.|:.       |:...:....|.:.|||..|:|
Human   138 IVE--ISSDISINEGNNISLTCIATGRPEPTVTWRH-------ISPKAVGFVSEDEYLEIQGITR 193

  Fly   285 LDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTR 349
            ...|.|.|.|||.|...|.:|:||:|::|| .:...:..|.|.|...|::|...|.|::...|.:
Human   194 EQSGDYECSASNDVAAPVVRRVKVTVNYPP-YISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYK 257

  Fly   350 GEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP 414
            .:..:|......|||....|      .||...|||..|.|.|.|||.|..|.|:..|.|:....|
Human   258 DDKRLIEGKKGVKVENRPFL------SKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEP 316

  Fly   415 TTAS 418
            |:::
Human   317 TSST 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/97 (30%)
Ig 130..200 CDD:143165 19/70 (27%)
I-set 226..310 CDD:254352 33/84 (39%)
IGc2 233..298 CDD:197706 25/65 (38%)
Ig 313..410 CDD:299845 31/97 (32%)
IG_like 325..410 CDD:214653 28/85 (33%)
NTMXP_016873341.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80529775
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 1 1.000 H41139
Inparanoid 1 1.050 131 1.000 Inparanoid score I4553
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T130085
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.