DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and CNTN3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_065923.1 Gene:CNTN3 HGNCID:2173 Length:1028 Species:Homo sapiens

Alignment Length:404 Identity:102/405 (25%)
Similarity:159/405 (39%) Gaps:92/405 (23%)


  Fly    49 PS--GSKT-VATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVV 110
            ||  |:.| |.|.:|.|            ..|.||.| ..|:.|:||:    |...|    .|.|
Human   188 PSDVGNYTCVVTSMVTN------------ARVLGSPT-PLVLRSDGVM----GEYEP----KIEV 231

  Fly   111 EEPEFTEYIENVTVPA--GRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHD 173
            :.||        |:||  |..|||.|........::.|                .|:..:..:..
Human   232 QFPE--------TLPAAKGSTVKLECFALGNPIPQINW----------------RRSDGLPFSSK 272

  Fly   174 KHDRHRTWYLHINNVHEEDRGRYMCQINTVTAK-TQFGYLNVVVPPNIDDSLSSSDVIVREGANI 237
            ...|..:..|.|.|..:||.|.|.|.......| ...|.|.....|:....:...::.|.:  ::
Human   273 IKLRKFSGVLEIPNFQQEDAGSYECIAENSRGKNVARGRLTYYAKPHWVQLIKDVEIAVED--SL 335

  Fly   238 SLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN--GVPP 300
            ...|||||.|:|..:|.::..:.:...:..|    |...|.|:.:|..|.|.:.|||.|  |:..
Human   336 YWECRASGKPKPSYRWLKNGAALVLEERTQI----ENGALTISNLSVTDSGMFQCIAENKHGLVY 396

  Fly   301 TVSKRIKVSVDFPPMLLIP-HQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVE 364
            : |..:||....|.....| .:||....|..|:::|...|.|.:|:.|.:|:..:          
Human   397 S-SAELKVVASAPDFSKNPMKKLVQVQVGSLVSLDCKPRASPRALSSWKKGDVSV---------- 450

  Fly   365 ATVGLPAYKTHMKLTII--------NVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP--TTASS 419
                    :.|.:::::        ||:..|.|.|.|:|:|..|:.:|...|.|:.|.  |.|.|
Human   451 --------QEHERISLLNDGGLKIANVTKADAGTYTCMAENQFGKANGTTHLVVTEPTRITLAPS 507

  Fly   420 GIYSTDTHWGENGI 433
            .:   |...||:.|
Human   508 NM---DVSVGESVI 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/99 (22%)
Ig 130..200 CDD:143165 15/70 (21%)
I-set 226..310 CDD:254352 24/86 (28%)
IGc2 233..298 CDD:197706 20/67 (30%)
Ig 313..410 CDD:299845 24/106 (23%)
IG_like 325..410 CDD:214653 20/93 (22%)
CNTN3NP_065923.1 Ig 25..114 CDD:299845
I-set 26..117 CDD:254352
Ig 120..214 CDD:299845 12/39 (31%)
IG_like 130..200 CDD:214653 6/12 (50%)
Ig 227..315 CDD:299845 27/116 (23%)
IG_like 234..313 CDD:214653 24/103 (23%)
I-set 318..403 CDD:254352 24/92 (26%)
Ig 320..403 CDD:299845 23/90 (26%)
IG_like 419..496 CDD:214653 21/95 (22%)
Ig 424..496 CDD:299845 20/90 (22%)
IG_like 506..594 CDD:214653 5/17 (29%)
Ig 515..598 CDD:299845 2/5 (40%)
FN3 598..695 CDD:238020
FN3 703..795 CDD:238020
FN3 805..898 CDD:238020
FN3 906..991 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.