DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dpr12

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster

Alignment Length:232 Identity:66/233 (28%)
Similarity:96/233 (41%) Gaps:37/233 (16%)


  Fly    97 GGANVPT---SNLNIVVEEPEFTE---YIENVTVPAGRNVKLGCSVKNLGSY-----KVAWMHFE 150
            ||.|..:   :||: ..:.|.|.:   ...|.||..|....|.|.|..:...     :::|:...
  Fly    57 GGINGDSKLDNNLD-SSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRR 120

  Fly   151 QSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTA-KTQFGYLNV 214
            ...||:....:.|.:.|.::.|....  ..|.|.|..|...|.|.|.||::|.|. .:.|..|.|
  Fly   121 DWHILSSGAQLYTNDERFAILHTPGS--NMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQV 183

  Fly   215 VVPPNIDDSLSSSDVIVREGANISLRCRASGSPRP--IIKWKRDDNSRIAINKNHIVNEWEGDTL 277
            |||...  .|.|.::.|..|:.|:|.|....||.|  .:.|:::|.   .||   .|:.....|:
  Fly   184 VVPEAF--ILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDR---LIN---YVDSRRDITI 240

  Fly   278 EIT----RISRL--------DMGAYLCIASNGVPPTV 302
            |.|    ..|||        |.|.|.|.|||..|.::
  Fly   241 ETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASI 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/102 (27%)
Ig 130..200 CDD:143165 18/75 (24%)
I-set 226..310 CDD:254352 28/92 (30%)
IGc2 233..298 CDD:197706 25/79 (32%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
dpr12NP_652462.3 IG_like 86..183 CDD:214653 26/99 (26%)
V-set 87..184 CDD:284989 26/99 (26%)
IG_like 193..272 CDD:214653 27/85 (32%)
Ig 204..271 CDD:143165 23/73 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.