DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and OPCML

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML HGNCID:8143 Length:354 Species:Homo sapiens

Alignment Length:342 Identity:100/343 (29%)
Similarity:151/343 (44%) Gaps:59/343 (17%)


  Fly    91 GVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAIL 155
            ||.|..|.|..|.:              ::||||..|.:..|.|::.:..: :|||::  :|.||
Human    28 GVPVRSGDATFPKA--------------MDNVTVRQGESATLRCTIDDRVT-RVAWLN--RSTIL 75

  Fly   156 TVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVT-AKTQFGYLNVVVPPN 219
            ...|...:.:||:.:..:...::.   :.|.||...|.|.|.|.:.|.. .||...:|.|.|||.
Human    76 YAGNDKWSIDPRVIILVNTPTQYS---IMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQ 137

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHI-VNEWEG-----DTLE 278
            |.:  .|||:.|.||::::|.|.|.|.|.|.:.|:            |: |.|.:|     :.||
Human   138 IMN--ISSDITVNEGSSVTLLCLAIGRPEPTVTWR------------HLSVKEGQGFVSEDEYLE 188

  Fly   279 ITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTS 343
            |:.|.|...|.|.|.|.|.|.....:::|::|::|| .:...:..|...|....:.|...|.|.:
Human   189 ISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPP-YISKAKNTGVSVGQKGILSCEASAVPMA 252

  Fly   344 LNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMK-----LTIINVSSGDDGIYKCVAKNPRGETD 403
            ...|           .|.:.....||...:...|     ||..|||..|.|.|.|||.|..|.|:
Human   253 EFQW-----------FKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTN 306

  Fly   404 GIIRLYVSYPPTTASSG 420
            ..|.|| ...|::|.:|
Human   307 ASITLY-EISPSSAVAG 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/97 (29%)
Ig 130..200 CDD:143165 18/70 (26%)
I-set 226..310 CDD:254352 29/90 (32%)
IGc2 233..298 CDD:197706 23/71 (32%)
Ig 313..410 CDD:299845 29/102 (28%)
IG_like 325..410 CDD:214653 26/90 (29%)
OPCMLNP_001306032.1 Ig 44..132 CDD:325142 27/94 (29%)
Ig_3 135..206 CDD:316449 29/85 (34%)
IG_like 234..312 CDD:214653 25/89 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80731206
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4553
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T130085
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.