DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and NCAM2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 HGNCID:7657 Length:874 Species:Homo sapiens

Alignment Length:412 Identity:98/413 (24%)
Similarity:154/413 (37%) Gaps:72/413 (17%)


  Fly    48 HPSGSKTVATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGG-------GANVPTSN 105
            :|.|.|.::|..|               .|...|..|.:...|..|...|       .|...|..
Human    80 NPQGEKIISTQRV---------------VVQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQE 129

  Fly   106 LNIVVE---EPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPR 167
            ..:|:|   :..|.|.:.......|.:.::.|.|.:..:..|:|::         ||..:|    
Human   130 ATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSSSPAPAVSWLY---------HNEEVT---- 181

  Fly   168 ISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVV----VPPNIDDSLSSSD 228
             :::.::........|.|.|:::.|.|.|.|: ..|.|:.:..:.:::    |||.|.....|.:
Human   182 -TISDNRFAMLANNNLQILNINKSDEGIYRCE-GRVEARGEIDFRDIIVIVNVPPAISMPQKSFN 244

  Fly   229 VIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEIT--RISRLDMGAYL 291
            .....|..::..|||||||.|.|.|.| :...|..|:.:|:   :|...|:|  .|...|.|.|:
Human   245 ATAERGEEMTFSCRASGSPEPAISWFR-NGKLIEENEKYIL---KGSNTELTVRNIINSDGGPYV 305

  Fly   292 CIASNGVPPTVSKRIKVSVD----FPPMLLIPH--QLVGAP--EGFNVTIECFTEAHPTSLNYWT 348
            |.|:|          |...|    |..:.:.||  ||....  |...||:.|..|..|.....|.
Human   306 CRATN----------KAGEDEKQAFLQVFVQPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWK 360

  Fly   349 RGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYP 413
            |.............::..:.:........|.|.:|...|.|.|.|.|.:..|.....:.|.:.|.
Human   361 RAVDGFTFTEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYA 425

  Fly   414 PTTASS-GIYSTDTHWGENGIN 434
            |...|: .||.:   |..|.||
Human   426 PKFISNQTIYYS---WEGNPIN 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 17/100 (17%)
Ig 130..200 CDD:143165 14/70 (20%)
I-set 226..310 CDD:254352 27/86 (31%)
IGc2 233..298 CDD:197706 25/67 (37%)
Ig 313..410 CDD:299845 22/101 (22%)
IG_like 325..410 CDD:214653 18/87 (21%)
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274 15/72 (21%)
I-set 47..136 CDD:254352 15/71 (21%)
I-set 142..218 CDD:254352 19/91 (21%)
IGc2 153..214 CDD:197706 15/76 (20%)
Ig 233..326 CDD:299845 32/107 (30%)
I-set 240..323 CDD:254352 29/97 (30%)
Ig5_NCAM-2 325..422 CDD:143278 22/97 (23%)
IG_like 333..420 CDD:214653 17/87 (20%)
IG_like 438..515 CDD:214653 4/8 (50%)
IGc2 439..507 CDD:197706 3/7 (43%)
FN3 521..613 CDD:238020
fn3 619..703 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.