DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and NCAM1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 HGNCID:7656 Length:884 Species:Homo sapiens

Alignment Length:469 Identity:104/470 (22%)
Similarity:185/470 (39%) Gaps:92/470 (20%)


  Fly    80 SGTGSTVVGSN----GV---IVAGGGANVPTSNLNIVVEEPEFTEYI-ENVTVP----AGRNVKL 132
            |.:..|:..:|    |:   :|.|...:...:.:|:.:    |.:.: :|...|    .|.:..:
Human    77 SSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKI----FQKLMFKNAPTPQEFREGEDAVI 137

  Fly   133 GCSVKNLGSYKVAWMHFEQSAIL--TVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGR 195
            .|.|.:.....:.|.|..:..||  .|...|::.|                ||.|..:.:.|.|.
Human   138 VCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNN----------------YLQIRGIKKTDEGT 186

  Fly   196 YMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGAN----ISLRCRASGSPRPIIKWKRD 256
            |.|: ..:.|:.:..:.::.|..|:..::.:...||...||    ::|.|.|.|.|.|.:.|.:|
Human   187 YRCE-GRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKD 250

  Fly   257 DN--SRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGV-PPTVSKRIKVSVDFPPMLLI 318
            ..  .:...::.:|.:: :...|.|.::.:.|...|:|||.|.. ....:..:||... |.:..:
Human   251 GEQIEQEEDDEKYIFSD-DSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAK-PKITYV 313

  Fly   319 PHQLVGAPEGFNVTIECFTEAHP-TSLNY--------------WTRGEGPIIHDSHKYKV----- 363
            .:|.....|. .||:.|.....| .|:.:              |||.|...:|....::|     
Human   314 ENQTAMELEE-QVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQEVHAPWNWQVGRQKG 377

  Fly   364 -EATVGLP-AYKT---HM---------KLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP 414
             ..:.|.| :::|   ||         .||:.::...|.|.|.|.|.|..|:....:.|.|.|.|
Human   378 QAGSAGFPGSHETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAP 442

  Fly   415 TTASS-GIYSTDTHWGENGIN---NNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGL--SEQKSFL 473
            ..... .:|:    |..|.:|   ..:||  |.:|.| :.:|......||.:.|.:  :...|:|
Human   443 KLQGPVAVYT----WEGNQVNITCEVFAY--PSATIS-WFRDGQLLPSSNYSNIKIYNTPSASYL 500

  Fly   474 DKTQNPLLANGNAN 487
            :.|.:.....||.|
Human   501 EVTPDSENDFGNYN 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/102 (20%)
Ig 130..200 CDD:143165 16/72 (22%)
I-set 226..310 CDD:254352 23/91 (25%)
IGc2 233..298 CDD:197706 19/71 (27%)
Ig 313..410 CDD:299845 29/131 (22%)
IG_like 325..410 CDD:214653 27/119 (23%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 7/42 (17%)
IG 124..190 CDD:214652 18/82 (22%)
Ig 211..307 CDD:325142 23/97 (24%)
Ig 306..438 CDD:325142 29/134 (22%)
Ig_3 447..519 CDD:316449 19/76 (25%)
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.