DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and tutl

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster

Alignment Length:482 Identity:105/483 (22%)
Similarity:172/483 (36%) Gaps:110/483 (23%)


  Fly    83 GSTVVGSNGVIVAGGGANVPTSNLNIV--------------VEEPEFTEYIENVTVPAGRNVKLG 133
            ||::.    |.:..|..:.||..:.::              .:.....|...::|...|..|...
  Fly    89 GSSIC----VPIRRGQGSTPTPTIQVLQFVLVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFN 149

  Fly   134 CSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWY---------------- 182
            |.|:....:.|.              :|:..:.::|.|......: .||                
  Fly   150 CHVEFPNDHPVP--------------YVLQWDKKVSETGSDLPIY-IWYESYPEHIEEGYKGRVS 199

  Fly   183 ------------LHINNVHEEDRGRYMCQI---NTVTAKTQFG---YLNVVVPPNIDDSLSSSDV 229
                        |::.|:.|.|:|.|.|::   |....:.:.|   :|:|..||..  |::..|:
  Fly   200 RVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRF--SVTPEDI 262

  Fly   230 I-VREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEW-EGDTLEITRISRLDMGAYLC 292
            | |..|.:|.|.|:|.|:|.|.|.|.:|.|   .::.:..|..: :|..|.|:.|...|:|.|.|
  Fly   263 IYVNLGDSIILNCQADGTPTPEILWYKDAN---PVDPSPTVGIFNDGTELRISTIRHEDIGEYTC 324

  Fly   293 IASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY-WTRGEGPIIH 356
            ||.|| ...||...:|.:....::::|.......||..|...|..:|.|.::.. |.| ||..:.
  Fly   325 IARNG-EGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYR-EGSPVR 387

  Fly   357 DSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGI-IRLYVSYPPTTASSG 420
            :....:...|:     :....|.|..:...|.|.|.|...|..|:.... ..|.|.||     :.
  Fly   388 EVAALETRVTI-----RKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYP-----AK 442

  Fly   421 IYSTDT----HWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSFLDKTQN--- 478
            :..|.|    .:...|:...|....|......:.:||.......:.:|.:....|.|....|   
  Fly   443 VTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEH 507

  Fly   479 -------PLLANGNANEADAESNGARG 498
                   |..|.|.|        ||.|
  Fly   508 QGQYACTPYNAQGTA--------GASG 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/130 (17%)
Ig 130..200 CDD:143165 16/98 (16%)
I-set 226..310 CDD:254352 31/86 (36%)
IGc2 233..298 CDD:197706 25/66 (38%)
Ig 313..410 CDD:299845 21/99 (21%)
IG_like 325..410 CDD:214653 20/87 (23%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 22/128 (17%)
IG_like 137..229 CDD:214653 18/107 (17%)
I-set 253..341 CDD:254352 33/94 (35%)
IGc2 268..331 CDD:197706 25/67 (37%)
I-set 346..437 CDD:254352 21/97 (22%)
Ig 349..437 CDD:299845 21/94 (22%)
Ig 459..530 CDD:299845 15/77 (19%)
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.