DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and opcml

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio

Alignment Length:293 Identity:100/294 (34%)
Similarity:148/294 (50%) Gaps:27/294 (9%)


  Fly   120 ENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLH 184
            :|:||..|.:..|.||:.|..| :|||::  ::.||...|...:.:||:.:.:...:.:.   :.
Zfish    40 DNITVRQGDSAVLKCSMDNKVS-RVAWLN--RTTILFTGNEKWSLDPRVVLLNTAVNEYS---IK 98

  Fly   185 INNVHEEDRGRYMCQI--NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSP 247
            |.||:..|.|.|:|.|  |.....|:. :|.|.||..|.:  .|:||.|.||:|:||.|.|.|.|
Zfish    99 ILNVNLYDEGPYVCSILTNKKPESTKV-HLIVQVPARIVN--VSTDVSVNEGSNVSLMCLAIGRP 160

  Fly   248 RPIIKWK-RDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVD 311
            .|.|.|| |....      |.||.  ||:.:|:|.|::...|:|.||.||.:.|...:.::|:|:
Zfish   161 EPSILWKFRSSKG------NRIVT--EGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVTVN 217

  Fly   312 FPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHM 376
            :||::..... .|...|....:.|...|.|.:...|.:||..|::..:..|:| ..|    |..|
Zfish   218 YPPVISRARS-TGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFNGVKIE-NKG----KQSM 276

  Fly   377 KLTIINVSSGDDGIYKCVAKNPRGETDGIIRLY 409
             ||..|||..|.|.|.|||.|..|.|:..|.||
Zfish   277 -LTFFNVSEEDYGNYTCVAINTLGITNASIILY 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/98 (30%)
Ig 130..200 CDD:143165 20/70 (29%)
I-set 226..310 CDD:254352 34/85 (40%)
IGc2 233..298 CDD:197706 28/66 (42%)
Ig 313..410 CDD:299845 33/98 (34%)
IG_like 325..410 CDD:214653 30/86 (35%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 28/95 (29%)
IG_like 41..129 CDD:214653 28/95 (29%)
IG_like 139..216 CDD:214653 34/85 (40%)
IGc2 146..202 CDD:197706 27/64 (42%)
I-set 219..307 CDD:254352 31/95 (33%)
ig 223..307 CDD:278476 29/91 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80526973
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.