DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and negr1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio

Alignment Length:335 Identity:102/336 (30%)
Similarity:150/336 (45%) Gaps:51/336 (15%)


  Fly   114 EFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRH 178
            ::|...|:|....|....|.|.:.: |..|.||::  :|:|:...|...:.:||:|:..:..|:|
Zfish    39 DYTTSSESVVSRQGDTALLRCYLLD-GISKGAWLN--RSSIIYAGNDKWSGDPRVSIVSNVGDKH 100

  Fly   179 RTWYLHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCR 242
            . :.|.|..|...|.|.|.|.|.:. ....:...|.|.|||.|.|  .|||:.|.||:|:||.|.
Zfish   101 E-YSLQIQKVDVTDEGVYTCSIQSERNLHPKLIQLIVKVPPKIYD--ISSDITVNEGSNVSLICA 162

  Fly   243 ASGSPRPIIKWKRDDNSRIAINKNHI---VNEWE-GDTLEITRISRLDMGAYLCIASNGVPPTVS 303
            |||.|.|.|.|:            ||   ..::| |:.|.||.|||...|.|.|.|.|.:....:
Zfish   163 ASGKPEPKISWR------------HISPSARKYESGEYLNITGISRDQAGDYECGAENDIASPDT 215

  Fly   304 KRIKVSVDFPPMLLIPHQLV--GAPEGFNVTIECFTEAHPTSLNYWTRGE-------GPIIHDSH 359
            |.::|:|:|||.:   |::.  |...|....:.|...|.|:.:..|.:||       |.:|::..
Zfish   216 KTVRVTVNFPPAI---HEMKSHGVRPGQVALLRCEAAAVPSPVFEWYKGEKRINMGQGIVINNLS 277

  Fly   360 KYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTAS--SGIY 422
            ...|              ||:.|::....|.|.|||.|..|..:..:.|.....|||.|  |...
Zfish   278 SRSV--------------LTVKNMTQDRYGNYTCVAVNRLGTANASVPLNPIIEPTTTSAVSSPA 328

  Fly   423 STDTHWGENG 432
            |....:|..|
Zfish   329 SNPAMYGSTG 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/97 (28%)
Ig 130..200 CDD:143165 21/70 (30%)
I-set 226..310 CDD:254352 34/88 (39%)
IGc2 233..298 CDD:197706 28/69 (41%)
Ig 313..410 CDD:299845 25/106 (24%)
IG_like 325..410 CDD:214653 21/92 (23%)
negr1XP_009300786.1 Ig 42..121 CDD:299845 24/83 (29%)
IG_like 44..136 CDD:214653 26/96 (27%)
I-set 140..222 CDD:254352 37/96 (39%)
IGc2 153..208 CDD:197706 27/67 (40%)
IG_like 236..312 CDD:214653 20/90 (22%)
IGc2 238..304 CDD:197706 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80618258
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T128591
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.622 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6406
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.