DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and robo2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001259868.1 Gene:robo2 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster

Alignment Length:522 Identity:123/523 (24%)
Similarity:191/523 (37%) Gaps:120/523 (23%)


  Fly    70 GAGGGGP---VAGSGTGST--VVGSNGV-IVAGGGANVPTSN-----------LNIVVEEPEFTE 117
            ||..|.|   ::....|.|  :||:..: ||.||...:..:.           .|:|......|.
  Fly   211 GAPRGSPEPQISWRKNGQTLNLVGNKRIRIVDGGNLAIQEARQSDDGRYQCVVKNVVGTRESATA 275

  Fly   118 YI------------ENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV 170
            ::            :|.|...|.:|...|.:.......|.|........:.:.        |:.|
  Fly   276 FLKVHVRPFLIRGPQNQTAVVGSSVVFQCRIGGDPLPDVLWRRTASGGNMPLR--------RVHV 332

  Fly   171 THDKHDRHRTWYLHINNVHEEDRGRYMCQI-NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREG 234
            ..|:.       |.:::|..||.|.|.|:. |.|...|..|.|.|..||..  .:...:.:|..|
  Fly   333 LEDRS-------LKLDDVTLEDMGEYTCEADNAVGGITATGILTVHAPPKF--VIRPKNQLVEIG 388

  Fly   235 ANISLRCRASGSPRPIIKWKRDDNSRIAI-----NKNHIVNEWEG-DTLEITRISRLDMGAYL-C 292
            ..:...|:|:|.|||.:.|..:.||.:.:     .:..:....|| ..|.|.|.:|.|.|..: |
  Fly   389 DEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVTLTPEGRSVLSIARFAREDSGKVVTC 453

  Fly   293 IASNGVPPTVSKRIKVSVD----FPPMLL--------IPHQLVGAPEGFNVTIECFTEAHPTSLN 345
            .|.|.| .:||.|..||||    .||.::        :|.:.:       |.:.|.|...|....
  Fly   454 NALNAV-GSVSSRTVVSVDTQFELPPPIIEQGPVNQTLPVKSI-------VVLPCRTLGTPVPQV 510

  Fly   346 YWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVS-SGDDGIYKCVAKNPRGET--DGIIR 407
            .|.....||....|:.:..:..|        .|||.::. ..|:|:|.|||.|..|::  .|.:|
  Fly   511 SWYLDGIPIDVQEHERRNLSDAG--------ALTISDLQRHEDEGLYTCVASNRNGKSSWSGYLR 567

  Fly   408 LYVSYPPTTASSGIY-----STDTHWGENGINNNYAYGGPDSTRSIYAQDKN--TRYQSNLNEIG 465
            |..   ||..:...:     ||              |.||.....:..:.:|  |...:..|::|
  Fly   568 LDT---PTNPNIKFFRAPELST--------------YPGPPGKPQMVEKGENSVTLSWTRSNKVG 615

  Fly   466 LSEQKSFLDKTQNPLLANGNANEADA-ESNGARGHNPSMAIAWLFVVIATLLLTIRSAVGSSHSL 529
            .|....:       ::.....||.|. .:.|.|..|.:.....|...:....| ||:.  :||.|
  Fly   616 GSSLVGY-------VIEMFGKNETDGWVAVGTRVQNTTFTQTGLLPGVNYFFL-IRAE--NSHGL 670

  Fly   530 SL 531
            ||
  Fly   671 SL 672

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 23/97 (24%)
Ig 130..200 CDD:143165 14/70 (20%)
I-set 226..310 CDD:254352 28/91 (31%)
IGc2 233..298 CDD:197706 21/72 (29%)
Ig 313..410 CDD:299845 26/108 (24%)
IG_like 325..410 CDD:214653 23/88 (26%)
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317
I-set 91..184 CDD:254352
I-set 190..279 CDD:254352 15/68 (22%)
Ig2_Robo 193..279 CDD:143201 15/68 (22%)
I-set 283..370 CDD:254352 22/102 (22%)
Ig 300..370 CDD:299845 19/85 (22%)
Ig 388..>457 CDD:299845 20/69 (29%)
I-set 479..561 CDD:254352 21/97 (22%)
Ig 496..561 CDD:143165 20/73 (27%)
FN3 588..681 CDD:238020 22/96 (23%)
FN3 <817..856 CDD:238020
fn3 864..952 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.