DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DIP-gamma

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster

Alignment Length:371 Identity:146/372 (39%)
Similarity:202/372 (54%) Gaps:44/372 (12%)


  Fly   112 EPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHD 176
            :|||..:|.|||.||||...|.|||:|||..||.|:......:|.:...|:|.|.||||.|  .|
  Fly    38 DPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMH--QD 100

  Fly   177 RHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRC 241
            .| ||.|.|:.:.|.|||.|||||||...|.|.|.::|.|||:|.:..||:|:.|:||.:.:|.|
  Fly   101 MH-TWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTC 164

  Fly   242 RASGSPRPIIKWKRDDNSRIAINKNHI-----VNEWEGDTLEITRISRLDMGAYLCIASNGVPPT 301
            :|:|:|:|.:.|:|:|...|.|.|...     |..:.|.:|.:.|:.|..||||||||||.|||.
  Fly   165 KATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPA 229

  Fly   302 VSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRG---------------- 350
            ||||:.:||.|.||:..|.||:|.|.|.:|.:||..||.|:.::||.:|                
  Fly   230 VSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLE 294

  Fly   351 ---EGP-IIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLY-- 409
               .|| ::.|..||.:  |.....|:..|.|.:.:.|..|.|.|.||:.|..|..:|.:|||  
  Fly   295 SGSPGPEMLLDGPKYGI--TERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEI 357

  Fly   410 VSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNT 455
            ..:|..:||:     |.|.       ||..|..::.|:....::.|
  Fly   358 KLHPGASASN-----DDHL-------NYIGGLEEAARNAGRSNRTT 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 47/96 (49%)
Ig 130..200 CDD:143165 33/70 (47%)
I-set 226..310 CDD:254352 40/89 (45%)
IGc2 233..298 CDD:197706 29/70 (41%)
Ig 313..410 CDD:299845 38/119 (32%)
IG_like 325..410 CDD:214653 32/107 (30%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 47/95 (49%)
Ig 47..129 CDD:299845 43/85 (51%)
Ig 140..238 CDD:299845 44/98 (45%)
IG_like 247..355 CDD:214653 35/110 (32%)
Ig 256..351 CDD:299845 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I2478
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.