DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and klg

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster

Alignment Length:409 Identity:108/410 (26%)
Similarity:178/410 (43%) Gaps:42/410 (10%)


  Fly    59 VVPNFGGAAGNGAGGGG---PVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIE 120
            :|.:.|......||.||   ..|.|..||.....:.|..:...|:..|:.|      |.|.....
  Fly    50 IVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATL------PRFLSRGH 108

  Fly   121 NVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHI 185
            ......|..:.|.|.|:|||::.:.|.  ..:.:||..|.::||:.|:.:...       :.|.|
  Fly   109 TYRAVVGDTLVLPCQVENLGNFVLLWR--RGTNVLTASNIMVTRDERVRLIDG-------YNLEI 164

  Fly   186 NNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPI 250
            :::..:|.|.|:|||:....:.|...:.::|||::....:|..:..|:|..|:|.|:.||:|.|.
  Fly   165 SDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPS 229

  Fly   251 IKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPM 315
            |.|.:...:    ||: .....:|..|.:.::.|...|.|.|.|.|||...|:..:::.|.:||.
  Fly   230 IYWTKKSGA----NKS-TARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPD 289

  Fly   316 LLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTI 380
            :.:....:.:.|||...:.|...|.|.:...|.:...||  .|...::.||    ....|| |||
  Fly   290 IQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPI--QSTDRRIMAT----RANRHM-LTI 347

  Fly   381 INVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNY-----AYG 440
            .::...|.|.|.|||.|..|.:    |.|:.......::..||  ..||.:..:.|.     :|.
  Fly   348 RHIQQEDFGNYSCVADNSLGRS----RKYMELSGRPGAAEFYS--PKWGRSPDSYNLTWKIDSYP 406

  Fly   441 GPDSTRSIYAQ-DKNTRYQ 458
            ..:..|.:|.: ..|..||
  Fly   407 PLEEVRLLYRRVQMNETYQ 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 23/96 (24%)
Ig 130..200 CDD:143165 20/70 (29%)
I-set 226..310 CDD:254352 25/84 (30%)
IGc2 233..298 CDD:197706 21/65 (32%)
Ig 313..410 CDD:299845 29/97 (30%)
IG_like 325..410 CDD:214653 27/85 (32%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 16/67 (24%)
IG_like 109..195 CDD:214653 23/95 (24%)
Ig 118..191 CDD:143165 22/82 (27%)
IG_like 205..274 CDD:214653 24/74 (32%)
IGc2 213..273 CDD:197706 22/65 (34%)
IGc2 301..367 CDD:197706 24/73 (33%)
FN3 392..486 CDD:238020 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80497671
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.