DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dpr15

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster

Alignment Length:537 Identity:111/538 (21%)
Similarity:159/538 (30%) Gaps:153/538 (28%)


  Fly    16 AATAGDSTNKIILPQILNGGGGGGGVGTA------------QGKH----PSGSKTVATGVVPN-- 62
            ||....|:|.:.:..|.|.|.....:..|            |.:|    ...:.|.|..:.||  
  Fly    79 AAAPNRSSNNVAINNISNNGDQRLRLTAALEANLIMSNRNVQEQHSYRITQDNATSAASIAPNGT 143

  Fly    63 -FGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYI------- 119
             ||.|.....|     ....|.:|:         ......||:........|..|..:       
  Fly   144 AFGDAPSIPIG-----VAPATTTTI---------DPATTTPTTTTRRTTRRPVATTTLKPPPTID 194

  Fly   120 --ENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRI-SVTHDKHDRHRTW 181
              :.:...||.:..|.|:||.|....::|:......||||.......:.|. ||.....:|   |
  Fly   195 DYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPER---W 256

  Fly   182 YLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS 246
            .|.|..|..:|.|.|.||::|....:...:|.:|.|..  :.:..|...|:.|:.:.|||..|.:
  Fly   257 SLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKT--ELIGESTRHVKAGSQVKLRCIISQA 319

  Fly   247 PRP--IIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIAS-------------- 295
            ..|  .|.|..:.......|:    ..|.      |.|.|:|:.|.:...|              
  Fly   320 LEPPLFINWFYNQKQIYLHNR----RGWR------TEIERIDLPAEVPTTSTTTTTTTTTASTTT 374

  Fly   296 ---NGVPPTVSKRIKVSVD-------FPPMLLIPHQLV------------GAPEGFNV-----TI 333
               :..|.|.|.....|.:       ...::.|....:            ||..|..|     |.
  Fly   375 TTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTA 439

  Fly   334 ECFTEAHPTSLNYWT-RGEGPIIHDSHKYKVEATVGL---------------PAYKTHM------ 376
            :..||...||....| .|.|.:...|..|...|..|:               .|:.|.|      
  Fly   440 QLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAAT 504

  Fly   377 ----------------------KLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASS 419
                                  .|.|..|...|.|.|.|...|....|..:..|...|..:...|
  Fly   505 TAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNSAPRTIVLHVLNGEYSASAIKS 569

  Fly   420 GIYSTDT--------HW 428
            |..|...        ||
  Fly   570 GSVSWSALIGCHGYLHW 586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/97 (29%)
Ig 130..200 CDD:143165 23/71 (32%)
I-set 226..310 CDD:254352 22/103 (21%)
IGc2 233..298 CDD:197706 16/84 (19%)
Ig 313..410 CDD:299845 30/158 (19%)
IG_like 325..410 CDD:214653 28/134 (21%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 27/95 (28%)
V-set 204..290 CDD:284989 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.