DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr17

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:272 Identity:67/272 - (24%)
Similarity:98/272 - (36%) Gaps:79/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYK 143
            |.|.||.|                ..||         |..:.|:|...|.:..:.|.:..|....
  Fly   397 GDGAGSAV----------------RRNL---------TMPVLNITAQMGNHAYMPCQIHRLSDKP 436

  Fly   144 VAWMHFEQSAILTVHNHVITRNPRI-SVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINT---VT 204
            |:|:....:.|::|.......:.|. |:..:.||  .||.|.|..|...|.|.|.||:.|   ::
  Fly   437 VSWVRMRDNHIISVDETTFIADERFQSIYQEDHD--YTWSLQIKYVEPSDAGWYECQMATEPKLS 499

  Fly   205 AKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS--PRPIIKWKR------DDNSR- 260
            ||.   :|.:|.|..  :.:......|:.|:.::|.|...|:  |...|.|.|      |.:.| 
  Fly   500 AKV---HLQIVKPKT--ELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERT 559

  Fly   261 -------------IAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDF 312
                         :..|:|.|      .:|.|..:.:.|.|.|.|..||.|        .||||.
  Fly   560 GWYTQLDRNIFGTVGDNQNTI------GSLIIPLVRKEDSGNYTCQPSNSV--------SVSVDL 610

  Fly   313 PPMLLIPHQLVG 324
                   |.|.|
  Fly   611 -------HVLSG 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/99 (27%)
Ig strand B 130..134 CDD:409405 0/3 (0%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 3/6 (50%)
IgI_1_MuSK 218..310 CDD:409562 24/113 (21%)
Ig strand A 218..221 CDD:409562 0/2 (0%)
Ig strand A' 226..231 CDD:409562 0/4 (0%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 2/4 (50%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 1/2 (50%)
Ig strand E 275..281 CDD:409562 2/5 (40%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 1/7 (14%)
IG_like 325..410 CDD:214653 67/272 (25%)
Ig strand B 331..335 CDD:143207
Ig strand C 344..348 CDD:143207
Ig strand E 376..380 CDD:143207
Ig strand F 390..395 CDD:143207
Ig strand G 403..406 CDD:143207
dpr17NP_731670.1 V-set 415..507 CDD:462230 26/96 (27%)
IG_like 521..612 CDD:214653 27/111 (24%)
Ig strand B 527..531 CDD:409353 1/3 (33%)
Ig strand C 542..546 CDD:409353 1/3 (33%)
Ig strand E 581..585 CDD:409353 1/3 (33%)
Ig strand F 595..600 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.