DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr17

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:272 Identity:67/272 - (24%)
Similarity:98/272 - (36%) Gaps:79/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYK 143
            |.|.||.|                ..||         |..:.|:|...|.:..:.|.:..|....
  Fly   397 GDGAGSAV----------------RRNL---------TMPVLNITAQMGNHAYMPCQIHRLSDKP 436

  Fly   144 VAWMHFEQSAILTVHNHVITRNPRI-SVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINT---VT 204
            |:|:....:.|::|.......:.|. |:..:.||  .||.|.|..|...|.|.|.||:.|   ::
  Fly   437 VSWVRMRDNHIISVDETTFIADERFQSIYQEDHD--YTWSLQIKYVEPSDAGWYECQMATEPKLS 499

  Fly   205 AKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS--PRPIIKWKR------DDNSR- 260
            ||.   :|.:|.|..  :.:......|:.|:.::|.|...|:  |...|.|.|      |.:.| 
  Fly   500 AKV---HLQIVKPKT--ELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERT 559

  Fly   261 -------------IAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDF 312
                         :..|:|.|      .:|.|..:.:.|.|.|.|..||.|        .||||.
  Fly   560 GWYTQLDRNIFGTVGDNQNTI------GSLIIPLVRKEDSGNYTCQPSNSV--------SVSVDL 610

  Fly   313 PPMLLIPHQLVG 324
                   |.|.|
  Fly   611 -------HVLSG 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/99 (27%)
Ig 130..200 CDD:143165 19/70 (27%)
I-set 226..310 CDD:254352 24/105 (23%)
IGc2 233..298 CDD:197706 21/86 (24%)
Ig 313..410 CDD:299845 3/12 (25%)
IG_like 325..410 CDD:214653 67/272 (25%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 21/78 (27%)
Ig 415..507 CDD:299845 26/96 (27%)
IG_like 521..612 CDD:214653 27/111 (24%)
IGc2 524..605 CDD:197706 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.