DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dpr5

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster

Alignment Length:237 Identity:69/238 (29%)
Similarity:104/238 (44%) Gaps:29/238 (12%)


  Fly   104 SNL---NIVVEEPEFTEYIENVTVPA-GRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITR 164
            |||   |....:|.|....:...:.| |...:|.|.|::||...|:|:......|||:.....|.
  Fly    78 SNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTN 142

  Fly   165 NPRISVTH-DKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSD 228
            :.|....| |..|.   |.|.|.:|.:.|.|.|.||::| ..|....|..|||.... ..|::.:
  Fly   143 DQRFLARHIDNSDE---WVLKIVSVQQRDAGVYECQVST-EPKISLAYKLVVVTSKA-QILANRE 202

  Fly   229 VIVREGANISLRCRASGSPRPI--IKWKRD-----DNSRIAINKNHIVNEWEGDT--LEITRISR 284
            :.::.|::|:|.|.|..:|.|.  :.|.:|     |::|..|   .:.:|.:..|  |.|:|:..
  Fly   203 LFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGI---RVESEQQMKTSNLVISRVQH 264

  Fly   285 LDMGAYLCIASNGVPPTVSKRIKVSVDFPPM-------LLIP 319
            .|.|.|.|.|.|....:|...|..|.....|       ||:|
  Fly   265 TDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLP 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 31/98 (32%)
Ig 130..200 CDD:143165 24/71 (34%)
I-set 226..310 CDD:254352 26/93 (28%)
IGc2 233..298 CDD:197706 23/74 (31%)
Ig 313..410 CDD:299845 4/15 (27%)
IG_like 325..410 CDD:214653
dpr5NP_650080.3 V-set 95..191 CDD:284989 31/100 (31%)
IG_like 98..179 CDD:214653 27/85 (32%)
IG_like 206..278 CDD:214653 23/75 (31%)
Ig 211..278 CDD:143165 22/70 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.