DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Ama

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster

Alignment Length:327 Identity:88/328 (27%)
Similarity:145/328 (44%) Gaps:22/328 (7%)


  Fly   105 NLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWM-----HFEQSAILTVHNHVITR 164
            :|:.|:..|..::..::|....|.:|:..|:|:.:|...|:|.     ....|.:|::.|.:...
  Fly    25 SLDSVLSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLP 89

  Fly   165 NPR--ISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQI-----NTVTAKTQFGYLNVVVPPNIDD 222
            :.|  ::||.........:...|.|:...|.|.|.||:     ..||.|..   |.:..||.|.:
  Fly    90 DQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLS---LQIKTPPVIAE 151

  Fly   223 SLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDM 287
            :...| .:|.||.|:.|.|.|:|.|:|.|.|.|:.|:.:... .|::.|   .||.|..:.|:|.
  Fly   152 NTPKS-TLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAG-GHLLAE---PTLRIRSVHRMDR 211

  Fly   288 GAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEG 352
            |.|.|||.||......:.|:|.|:|.|.:.:....:......:..:||..:.:|.....|.:...
  Fly   212 GGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGV 276

  Fly   353 PIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTA 417
            | :..|..::|..|.......|.: |.|.:|...|.|.|.|.|.|..|..|..:.|:.:..|..:
  Fly   277 P-LQSSRHHEVANTASSSGTTTSV-LRIDSVGEEDFGDYYCNATNKLGHADARLHLFQTVIPVPS 339

  Fly   418 SS 419
            .|
  Fly   340 LS 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 25/108 (23%)
Ig 130..200 CDD:143165 19/77 (25%)
I-set 226..310 CDD:254352 31/84 (37%)
IGc2 233..298 CDD:197706 27/65 (42%)
Ig 313..410 CDD:299845 22/97 (23%)
IG_like 325..410 CDD:214653 21/85 (25%)
AmaNP_731114.2 I-set 33..143 CDD:254352 26/113 (23%)
Ig 37..127 CDD:299845 21/90 (23%)
IG_like 154..234 CDD:214653 31/85 (36%)
IGc2 161..223 CDD:197706 27/66 (41%)
I-set 254..330 CDD:254352 20/78 (26%)
IGc2 254..322 CDD:197706 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80471941
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.