DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dpr11

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster

Alignment Length:319 Identity:89/320 (28%)
Similarity:125/320 (39%) Gaps:49/320 (15%)


  Fly     8 LIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPNFGGAAGNGAG 72
            |:|.:|.|...:...|:    .:...|...|.|.||::|...|.:...:|.:         :...
  Fly    31 LLGGILCLTIASHTQTS----AEAAGGRVSGPGAGTSEGAGTSSASAASTAI---------SSDE 82

  Fly    73 GGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEY-IENVTVPAGRNVKLGCSV 136
            .|.|  .|.|..:.:.....::....|...||.|    .||....| ..|||...|.:..|.|.|
  Fly    83 SGDP--SSATAFSSLAQVSSLLPEASALSATSGL----VEPYLDGYATSNVTTQIGTHAYLPCRV 141

  Fly   137 KNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH--DKHDRHRTWYLHINNVHEEDRGRYMCQ 199
            |.||:..|:|:......||||...|...:.|.....  ||:     |.|.|..|...|.|.|.||
  Fly   142 KQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKY-----WTLQIKYVQARDAGSYECQ 201

  Fly   200 INT---VTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS--PRPIIKWKRDDNS 259
            ::|   |:|:.|   |.||||..  :.|...|..|:.|:|:.|||...|:  |...|.|......
  Fly   202 VSTEPKVSARVQ---LQVVVPRT--EILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQ 261

  Fly   260 RIAINKNHIVN------EWEGD------TLEITRISRLDMGAYLCIASNGVPPTVSKRI 306
            ..|.::.|...      |..|:      :|.|....:.|.|.|.|..||....||:..|
  Fly   262 LAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNI 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 36/101 (36%)
Ig 130..200 CDD:143165 25/72 (35%)
I-set 226..310 CDD:254352 26/96 (27%)
IGc2 233..298 CDD:197706 21/79 (27%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
dpr11NP_001262320.1 I-set 125..216 CDD:254352 34/99 (34%)
Ig 127..217 CDD:299845 34/98 (35%)
IG_like 227..320 CDD:214653 25/93 (27%)
IGc2 234..311 CDD:197706 21/77 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.