DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dpr16

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster

Alignment Length:479 Identity:86/480 (18%)
Similarity:142/480 (30%) Gaps:188/480 (39%)


  Fly    35 GGGGGGVGTAQGKHP-SGSKTVATGVVPNFGGAAGNGAGGGGP------VAGSGTGSTVVGSNG- 91
            ||.|.|:....|:.| :.|..:|.....:|.|.....|....|      :|...||::.:||.| 
  Fly    21 GGRGAGILAGSGRSPGTASILLAFLAAVSFRGMRAPLAATATPMENASLIASPATGTSTMGSAGS 85

  Fly    92 -VIVAG--------------GGANVP-----TSNLNIVVEEPEFTEYIE---------------- 120
             |::.|              ..::.|     |...:|....|.|.|:|.                
  Fly    86 PVLMLGDDQQQQEYDTTVVDSWSDRPDTATLTKGFSIPSYLPPFPEFIPADLPHMLRNASSGAAP 150

  Fly   121 --------------------------------------------------------NVTVPAGRN 129
                                                                    |.||.||::
  Fly   151 PADIGPSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLNATVQAGQH 215

  Fly   130 VKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPR------------------ISVT----- 171
            ..|.|.:.......::|:......|:.|.:.....:.|                  :|.|     
  Fly   216 AYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGALSTTATPVA 280

  Fly   172 --------------HDKHDRHRTWYLHINNVHEEDRGRYMCQINT---VTAKTQFGYLNVVVPPN 219
                          ...:....:|.|.|..|:.||.|.|.||:.|   ::||.|   |.|:.|..
  Fly   281 ALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQ---LFVITPRT 342

  Fly   220 IDDSLSSSDVIVREGANISLRCRASG---SPRPIIKWKRDDNSRIAINK-------------NHI 268
              :.:......|:.|:.:.|.|...|   :|:.|. |.|.|....|.|:             .:|
  Fly   343 --ELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIF-WYRGDQQVTAENEASGAQSGWYTQIDRNI 404

  Fly   269 VNEWEGD-----TLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLL-----IPHQLV 323
            ....|.:     :|.|..:.::..|.|.|...|....::...: :|.::....:     .||:| 
  Fly   405 FGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHV-LSGEYSASAIKSTAARPHRL- 467

  Fly   324 GAPEGFNVTIECFTEAHPTSLNYW 347
              ..|:            |||:.|
  Fly   468 --GHGY------------TSLHQW 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/208 (14%)
Ig 130..200 CDD:143165 18/107 (17%)
I-set 226..310 CDD:254352 21/105 (20%)
IGc2 233..298 CDD:197706 19/86 (22%)
Ig 313..410 CDD:299845 8/41 (20%)
IG_like 325..410 CDD:214653 5/24 (21%)
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 28/135 (21%)
Ig <298..338 CDD:299845 16/43 (37%)
IG_like 352..447 CDD:214653 20/96 (21%)
Ig 358..439 CDD:143165 18/82 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.