DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and LSAMP

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP HGNCID:6705 Length:361 Species:Homo sapiens

Alignment Length:355 Identity:110/356 (31%)
Similarity:163/356 (46%) Gaps:47/356 (13%)


  Fly   101 VPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRN 165
            :||   .:.|...:|....:|:||..|....|.|.|::..| ||||::  :|.|:...:...:.:
Human    23 LPT---GLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNS-KVAWLN--RSGIIFAGHDKWSLD 81

  Fly   166 PRISVTHDKHDRHRTWY-LHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPNIDDSLSSSD 228
            ||:.:    ..||...| |.|..|...|.|.|.|.:.|. ..||...||.|.|||.|  |..|||
Human    82 PRVEL----EKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKI--SNISSD 140

  Fly   229 VIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIV---NEWEGDT--LEITRISRLDMG 288
            |.|.||:|::|.|.|:|.|.|:|.|:            |:.   .|:||:.  |||..|:|...|
Human   141 VTVNEGSNVTLVCMANGRPEPVITWR------------HLTPTGREFEGEEEYLEILGITREQSG 193

  Fly   289 AYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGP 353
            .|.|.|:|.|.....|::||:|::|| .:...:...|..|...:::|...|.|.....|.| :..
Human   194 KYECKAANEVSSADVKQVKVTVNYPP-TITESKSNEATTGRQASLKCEASAVPAPDFEWYR-DDT 256

  Fly   354 IIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTAS 418
            .|:.::..::::|.|      ...||:.||:....|.|.|||.|..|.|:..:.|:....||...
Human   257 RINSANGLEIKSTEG------QSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTIPH 315

  Fly   419 SGIYSTDTHWGENGINNNYAYGGPDSTRSI 448
            .        ..|.|...::...||.|.|.|
Human   316 P--------IQEIGTTVHFKQKGPGSVRGI 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 32/98 (33%)
Ig 130..200 CDD:143165 22/71 (31%)
I-set 226..310 CDD:254352 34/89 (38%)
IGc2 233..298 CDD:197706 25/70 (36%)
Ig 313..410 CDD:299845 25/97 (26%)
IG_like 325..410 CDD:214653 23/85 (27%)
LSAMPNP_001305844.1 Ig 38..128 CDD:325142 31/97 (32%)
Ig_3 131..201 CDD:316449 33/84 (39%)
Ig 235..302 CDD:319273 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80608920
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T130085
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.