DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and CG7166

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster

Alignment Length:298 Identity:85/299 (28%)
Similarity:137/299 (46%) Gaps:26/299 (9%)


  Fly   113 PEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDR 177
            |:|........|..|..::|.|.|:||||:.:.|.  :.|::||..:..|||:.|..:..|    
  Fly    39 PKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLWR--KGSSVLTAGHLKITRDQRFKIVGD---- 97

  Fly   178 HRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCR 242
               :.|.||.|..:|.|.|:||:.....:.|...:.::|||.:.....:..|..|:|:.::|.|:
  Fly    98 ---YNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECK 159

  Fly   243 ASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIK 307
            |||:|.|.|.|.:.|   :.....|:.   :..||.:..:.|...|.|.|.|.|||...||..|:
  Fly   160 ASGNPVPTIFWFKKD---VFSGPTHLS---DSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQ 218

  Fly   308 VSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAY 372
            :::..||.:.:....|.|.||::|.:.|.......|...|.:         :.:.::||.....|
  Fly   219 LTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQ---------NSFLLDATDRRSMY 274

  Fly   373 KTHMKLTII--NVSSGDDGIYKCVAKNPRGETDGIIRL 408
            ....:.::|  |....|.|.|.|||.|..|.|...|.:
  Fly   275 PRDDRYSLIIRNFQPTDFGNYSCVADNALGRTKKYIEV 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/96 (29%)
Ig 130..200 CDD:143165 25/70 (36%)
I-set 226..310 CDD:254352 27/84 (32%)
IGc2 233..298 CDD:197706 21/65 (32%)
Ig 313..410 CDD:299845 25/99 (25%)
IG_like 325..410 CDD:214653 22/87 (25%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 28/92 (30%)
Ig 56..116 CDD:143165 24/69 (35%)
IG_like 144..221 CDD:214653 27/83 (33%)
IGc2 151..209 CDD:197706 21/64 (33%)
IG_like 232..313 CDD:214653 23/91 (25%)
Ig 242..311 CDD:143165 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.