DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and IGLON5

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens


Alignment Length:326 Identity:93/326 - (28%)
Similarity:137/326 - (42%) Gaps:40/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILT 156
            ::.|...|.:...:..::.:..||....:|.||..|.|..|.|.:....: :|||::  :|.||.
Human    12 LLAAAALAGLAVISRGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHVT-RVAWLN--RSNILY 73

  Fly   157 VHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINT--VTAKTQFGYLNVVVPPN 219
            ..|...|.:||:.:..:..:.   :.:.|..|...|.|.|.|...|  ....||. ||.|.||..
Human    74 AGNDRWTSDPRVRLLINTPEE---FSILITEVGLGDEGLYTCSFQTRHQPYTTQV-YLIVHVPAR 134

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWK--RDDNSRIAINKNHIVNEWEGDTLEITRI 282
            |.:  .||.|.|.||.|::|.|.|.|.|.|.:.|:  ||..:.            ||:.|||:.|
Human   135 IVN--ISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTS------------EGEILEISDI 185

  Fly   283 SRLDMGAYLCIASNGVPPTV-SKRIKVSVDFPPMLLIPHQLVGAPE--GFNVTIECFTEAHPTSL 344
            .|...|.|.|:..|||.... |:|:.|:|::||.:.   .:..|..  |....:.|...|.|.:.
Human   186 QRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTIT---DVTSARTALGRAALLRCEAMAVPPAD 247

  Fly   345 NYWTRGEGPIIHDSHKYKVEATVGLPAY--KTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIR 407
            ..|.:       |..........||...  :|...|...|||:...|.|.|.|.|..|.:...:|
Human   248 FQWYK-------DDRLLSSGTAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMR 305

  Fly   408 L 408
            |
Human   306 L 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/97 (30%)
Ig 130..200 CDD:143165 18/69 (26%)
I-set 226..310 CDD:254352 32/86 (37%)
IGc2 233..298 CDD:197706 23/66 (35%)
Ig 313..410 CDD:299845 24/100 (24%)
IG_like 325..410 CDD:214653 22/88 (25%)
IGLON5NP_001094842.1 Ig 41..129 CDD:416386 28/94 (30%)
Ig strand A' 41..46 CDD:409353 3/4 (75%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 3/9 (33%)
Ig strand C 61..67 CDD:409353 3/6 (50%)
CDR2 69..79 CDD:409353 4/9 (44%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 9/37 (24%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/8 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 4/9 (44%)
FR4 122..129 CDD:409353 4/7 (57%)
Ig_3 134..199 CDD:404760 27/78 (35%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 162..170 CDD:409353 2/7 (29%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig strand G 202..212 CDD:409353 2/9 (22%)
Ig_3 217..295 CDD:404760 20/87 (23%)
putative Ig strand A 218..224 CDD:409353 1/8 (13%)
Ig strand B 234..238 CDD:409353 0/3 (0%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143440
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.