DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and IGLON5

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 HGNCID:34550 Length:336 Species:Homo sapiens

Alignment Length:326 Identity:93/327 (28%)
Similarity:137/327 (42%) Gaps:40/327 (12%)


  Fly    92 VIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILT 156
            ::.|...|.:...:..::.:..||....:|.||..|.|..|.|.:....: :|||::  :|.||.
Human    12 LLAAAALAGLAVISRGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHVT-RVAWLN--RSNILY 73

  Fly   157 VHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINT--VTAKTQFGYLNVVVPPN 219
            ..|...|.:||:.:..:..:.   :.:.|..|...|.|.|.|...|  ....||. ||.|.||..
Human    74 AGNDRWTSDPRVRLLINTPEE---FSILITEVGLGDEGLYTCSFQTRHQPYTTQV-YLIVHVPAR 134

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWK--RDDNSRIAINKNHIVNEWEGDTLEITRI 282
            |.:  .||.|.|.||.|::|.|.|.|.|.|.:.|:  ||..:.            ||:.|||:.|
Human   135 IVN--ISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTS------------EGEILEISDI 185

  Fly   283 SRLDMGAYLCIASNGVPPTV-SKRIKVSVDFPPMLLIPHQLVGAPE--GFNVTIECFTEAHPTSL 344
            .|...|.|.|:..|||.... |:|:.|:|::||.:.   .:..|..  |....:.|...|.|.:.
Human   186 QRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTIT---DVTSARTALGRAALLRCEAMAVPPAD 247

  Fly   345 NYWTRGEGPIIHDSHKYKVEATVGLPAY--KTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIR 407
            ..|.:       |..........||...  :|...|...|||:...|.|.|.|.|..|.:...:|
Human   248 FQWYK-------DDRLLSSGTAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMR 305

  Fly   408 L 408
            |
Human   306 L 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/98 (30%)
Ig 130..200 CDD:143165 18/70 (26%)
I-set 226..310 CDD:254352 32/87 (37%)
IGc2 233..298 CDD:197706 24/67 (36%)
Ig 313..410 CDD:299845 24/101 (24%)
IG_like 325..410 CDD:214653 22/89 (25%)
IGLON5NP_001094842.1 Ig 41..129 CDD:325142 28/95 (29%)
Ig_3 134..199 CDD:316449 27/79 (34%)
Ig_3 217..295 CDD:316449 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80554869
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4553
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T130085
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.604 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.