DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr10

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:305 Identity:76/305 - (24%)
Similarity:101/305 - (33%) Gaps:103/305 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EPEFTEYI-ENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKH 175
            ||.|...: .|:|...|::..|||.||:||:..|||:......||||..:..|.:.|...::   
  Fly    52 EPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSY--- 113

  Fly   176 DRHR---TWYLHINNVHEEDRGRYMCQINT---------------VTAKT--------------- 207
              ||   .|.|.|....:.|.|.|.|||:|               :.|:|               
  Fly   114 --HRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYI 176

  Fly   208 ---------------QFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRP--IIKWKR 255
                           .||.:..|..|.. ..|...|:.|.:|:.|:|.|....||.|  .|.|..
  Fly   177 AENRVYQSSNDEFAGMFGPIQTVAVPTA-TILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYH 240

  Fly   256 DDNSRIAINKNHIVNEWEGDTLEITRISR--------------LDMGAYLCIASNGVPPTVSKRI 306
            .|..        :..|..|..|:...|..              |..|.|.|..||    |....|
  Fly   241 QDKV--------LSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN----TEIASI 293

  Fly   307 KVSVDFPPMLLIPHQLVG-APEGFNVTIECFTEAHP--TSLNYWT 348
            :|           |.|.| .||...      |.|.|  .:|..|:
  Fly   294 RV-----------HVLQGERPEAMQ------TNAAPAAVALACWS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 35/143 (24%)
Ig 130..200 CDD:143165 25/72 (35%)
I-set 226..310 CDD:254352 25/99 (25%)
IGc2 233..298 CDD:197706 20/80 (25%)
Ig 313..410 CDD:299845 10/39 (26%)
IG_like 325..410 CDD:214653 7/26 (27%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 30/84 (36%)
IG_like 210..297 CDD:214653 25/109 (23%)
IGc2 217..287 CDD:197706 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.