DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr10

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:305 Identity:76/305 - (24%)
Similarity:101/305 - (33%) Gaps:103/305 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EPEFTEYI-ENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKH 175
            ||.|...: .|:|...|::..|||.||:||:..|||:......||||..:..|.:.|...::   
  Fly    52 EPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSY--- 113

  Fly   176 DRHR---TWYLHINNVHEEDRGRYMCQINT---------------VTAKT--------------- 207
              ||   .|.|.|....:.|.|.|.|||:|               :.|:|               
  Fly   114 --HRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYI 176

  Fly   208 ---------------QFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRP--IIKWKR 255
                           .||.:..|..|.. ..|...|:.|.:|:.|:|.|....||.|  .|.|..
  Fly   177 AENRVYQSSNDEFAGMFGPIQTVAVPTA-TILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYH 240

  Fly   256 DDNSRIAINKNHIVNEWEGDTLEITRISR--------------LDMGAYLCIASNGVPPTVSKRI 306
            .|..        :..|..|..|:...|..              |..|.|.|..||    |....|
  Fly   241 QDKV--------LSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN----TEIASI 293

  Fly   307 KVSVDFPPMLLIPHQLVG-APEGFNVTIECFTEAHP--TSLNYWT 348
            :|           |.|.| .||...      |.|.|  .:|..|:
  Fly   294 RV-----------HVLQGERPEAMQ------TNAAPAAVALACWS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 35/143 (24%)
Ig strand B 130..134 CDD:409405 1/3 (33%)
Ig strand C 143..147 CDD:409405 2/3 (67%)
Ig strand E 178..185 CDD:409405 4/9 (44%)
IgI_1_MuSK 218..310 CDD:409562 27/107 (25%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 1/4 (25%)
Ig strand B 237..244 CDD:409562 3/6 (50%)
Ig strand C 250..255 CDD:409562 2/4 (50%)
Ig strand C' 257..259 CDD:409562 1/1 (100%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 1/5 (20%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 2/7 (29%)
IG_like 325..410 CDD:214653 7/26 (27%)
Ig strand B 331..335 CDD:143207 0/3 (0%)
Ig strand C 344..348 CDD:143207 1/3 (33%)
Ig strand E 376..380 CDD:143207
Ig strand F 390..395 CDD:143207
Ig strand G 403..406 CDD:143207
dpr10NP_729591.1 Ig 53..138 CDD:472250 29/89 (33%)
Ig strand B 71..75 CDD:409371 1/3 (33%)
Ig strand E 120..124 CDD:409371 2/3 (67%)
Ig_3 214..287 CDD:464046 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.