DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and TMIGD1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_996663.1 Gene:TMIGD1 HGNCID:32431 Length:262 Species:Homo sapiens

Alignment Length:207 Identity:49/208 (24%)
Similarity:91/208 (44%) Gaps:46/208 (22%)


  Fly   152 SAILTVH----NHVITRNPR------ISVTHDKHDRHRTWY------------------LHINNV 188
            |::|||:    |:::...|.      .:|.:...:....||                  :.::::
Human    28 SSVLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSI 92

  Fly   189 HEEDRG-RYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDV-IVREGANISLRCRASGSPRPII 251
            .|.|.| .:.|::....:.:....|||..||    .||.:|. .|.||:|:.|.|....:|:..:
Human    93 SENDNGISFTCRLGRDQSVSVSVVLNVTFPP----LLSGNDFQTVEEGSNVKLVCNVKANPQAQM 153

  Fly   252 KWKRDDNSRIAINKN-HIVNEW-EGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPP 314
            .|.: ::|.:.:.|: |.:.:. |...|.||::.:.|.|.|.|||.:.:...       |:||  
Human   154 MWYK-NSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTE-------SLDF-- 208

  Fly   315 MLLIPHQLVGAP 326
            .|::..:.||.|
Human   209 HLIVKDKTVGVP 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 16/93 (17%)
Ig 130..200 CDD:143165 13/77 (17%)
I-set 226..310 CDD:254352 23/87 (26%)
IGc2 233..298 CDD:197706 20/67 (30%)
Ig 313..410 CDD:299845 4/15 (27%)
IG_like 325..410 CDD:214653 1/3 (33%)
TMIGD1NP_996663.1 IG 131..212 CDD:214652 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.