DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Dscam2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster

Alignment Length:510 Identity:114/511 (22%)
Similarity:184/511 (36%) Gaps:136/511 (27%)


  Fly    61 PNFGGAAGNGAG-----GG------GPVAGSGTGSTVVGSNGVI---VAGGGANVPTSNLNIVVE 111
            |.:.....||||     .|      ||:...   ..|.|.:..:   .||......::.|.:.|.
  Fly   267 PEYSWFTHNGAGPLPVLSGPRVRLLGPILAI---EAVTGEDSGVYKCTAGNVGGEASAELRLTVA 328

  Fly   112 EPEFTEYIENV-TVPAGRNVKLGCSVKNLGS----YKVAWMHFEQSAILTVHNHVITRNPRISVT 171
            .|...|...|| :|..|...:..|.|.:.||    ..:.|..         ....:..:.|:..|
  Fly   329 TPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYK---------DGRQLPSSGRVEDT 384

  Fly   172 HDKHDRHRTWYLHINNVHEEDRGRYMCQIN-------TVTAKTQFGYLNVVVPPNIDDSLSSSDV 229
                       |.:..|..|:||.|.|.:.       ..||:.|.|    ..||.:  ..|..:.
  Fly   385 -----------LVVPRVSRENRGMYQCVVRRPEGDTFQATAELQLG----DAPPVL--LYSFIEQ 432

  Fly   230 IVREGANISLRCRASGSPRPIIKWKRD-----DNSRIAINKNHIVNEWEGDTLEITRISRL---D 286
            .::.|..:||:|.|:|:|.|.|.|..|     .|.|..|.:...|:   ||.:....||.:   |
  Fly   433 TLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVH---GDVISHVNISHVMVED 494

  Fly   287 MGAYLCIASNGVPPTVSKRIKVSV-DFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRG 350
            .|.|.|||.|.. ..|....:::: ..|.:.|||.  |.|..|..:.::|....:|....:|.||
  Fly   495 GGEYACIAENRA-GRVQHAARLNIYGLPYIRLIPK--VTAVSGETLNLKCPVAGYPIEEIHWERG 556

  Fly   351 EGPIIHDSHKYKVEATVGLPAYKTHMKLTIINV-SSGDDGIYKCVAKNPRGET---DGIIRLYVS 411
             |..:.|..:.:|:         ....|||..| .:.|.|:|.|.|:|.:|.:   .|.:.:.| 
  Fly   557 -GRELPDDIRQRVQ---------PDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIV- 610

  Fly   412 YPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSF---L 473
             ||                                      |.:.:|:|:.::.:.::.|.   :
  Fly   611 -PP--------------------------------------KLSPFQTNILQLNMGDRASLTCSV 636

  Fly   474 DKTQNPLLANGNANEADAESNGARGHNPSMAIAWLFVVIATLLLTIRSAVGSSHS 528
            .|...||..|...:        .|..:|:..::...|.....:|.|.: :||.|:
  Fly   637 VKGDLPLTINWRKD--------GRPIDPTQHMSVKQVDQYNSILVIEN-LGSDHT 682

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/108 (20%)
Ig 130..200 CDD:143165 14/74 (19%)
I-set 226..310 CDD:254352 27/92 (29%)
IGc2 233..298 CDD:197706 26/73 (36%)
Ig 313..410 CDD:299845 27/101 (27%)
IG_like 325..410 CDD:214653 22/89 (25%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352 13/63 (21%)
Ig 247..327 CDD:299845 13/63 (21%)
I-set 332..418 CDD:254352 22/106 (21%)
IGc2 344..407 CDD:197706 15/83 (18%)
IG_like 432..517 CDD:214653 27/89 (30%)
IGc2 436..507 CDD:197706 26/75 (35%)
I-set 521..610 CDD:254352 27/101 (27%)
IGc2 533..597 CDD:197706 19/74 (26%)
Ig 630..699 CDD:143165 13/63 (21%)
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.