DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and ImpL2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster

Alignment Length:279 Identity:60/280 (21%)
Similarity:100/280 (36%) Gaps:57/280 (20%)


  Fly   147 MHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGY 211
            :|....|:|...:....|...:.:..|.:|...:    |....|:.|.|..          :..:
  Fly     7 LHVCALALLLFGSIATVRGRAVDLVDDSNDVDNS----IEAEEEKPRNRAF----------EADW 57

  Fly   212 LNVV-VPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKW--------KRDD---------- 257
            |... .||.   .|..:|     ||.|.:.|...||..|.|:|        :.||          
  Fly    58 LKFTKTPPT---KLQQAD-----GATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEA 114

  Fly   258 -NSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFP----PMLL 317
             ::.:.:..:||::....:....|.:.|  .|:....||..|.|..|.|:.....:|    |.::
  Fly   115 PSAIVRVRSSHIIDHVLSEARTYTCVGR--TGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRII 177

  Fly   318 IPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIIN 382
            ...:......|.|:.:.|...|.|.:...|...|...|...|:::|.|         :..|.|..
  Fly   178 YTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLA---------NGDLLISE 233

  Fly   383 VSSGDDGIYKCVAKNPRGE 401
            :...|.|.|||:|:|..|:
  Fly   234 IKWEDMGNYKCIARNVVGK 252

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 11/70 (16%)
Ig 130..200 CDD:143165 10/53 (19%)
I-set 226..310 CDD:254352 23/103 (22%)
IGc2 233..298 CDD:197706 18/84 (21%)
Ig 313..410 CDD:299845 23/94 (24%)
IG_like 325..410 CDD:214653 21/78 (27%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.