DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and robo1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster

Alignment Length:479 Identity:117/480 (24%)
Similarity:183/480 (38%) Gaps:107/480 (22%)


  Fly   108 IVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH 172
            ||..:|.|.:..::..:..|:.....|||......||.|...|.:..::          |..:.|
  Fly   250 IVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIPVS----------RARILH 304

  Fly   173 DKHDRHRTWYLHINNVHEEDRGRYMCQ----INTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVRE 233
            |:..      |.|:|:...|.|.|:|:    :..::|:..   |.|..|||.....|:..|    
  Fly   305 DEKS------LEISNITPTDEGTYVCEAHNNVGQISARAS---LIVHAPPNFTKRPSNKKV---- 356

  Fly   234 GAN--ISLRCRASGSPRPIIKWKRDDNSRIAI-NKNHIVNEWEGD-TLEITRISRLDMGAYLCIA 294
            |.|  :.|.|.|||:|.|.:.|.::..|.:.. |.:|.......| ||:||.:.:.|.|.|:|.|
  Fly   357 GLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQEDEGYYVCSA 421

  Fly   295 SNGV-PPTVSKRIKV-SVDF--PPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPII 355
            .:.| ..||...::| |:|.  ||::.|.......|:|...|:.|....:|:....|       .
  Fly   422 FSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKW-------F 479

  Fly   356 HDSHKYKVEATVGLPAYKTHMKLTIINVSS--------GDDGIYKCVAKNPRGETDGIIRLYVSY 412
            ||.|           |.:...:.:||..||        .|.|.|.|.|...||||.....|.|..
  Fly   480 HDGH-----------AVQAGNRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEK 533

  Fly   413 PPTT-----ASSGIY---------------STDTHWGENG---------INNNYAYGGPD-STRS 447
            |.:|     |....|               |....|.::.         |.....|..|| .|..
  Fly   534 PGSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDLQTGW 598

  Fly   448 IYAQDKNTRYQSNLNEIGLSEQKSFL-----DKTQNPLLANGNAN-----EADAESNGARGHNPS 502
            |.|..:....|..::  ||:...|::     :.||...:.:|.:|     |||.::..|.    .
  Fly   599 IVAAQRVGDTQVTIS--GLTPGTSYVFLVRAENTQGISVPSGLSNTIKTIEADFDAASAN----D 657

  Fly   503 MAIAWLFVVIATLLLTIRSAVGSS 526
            ::.|...:...::.|...||:.:|
  Fly   658 LSAARTLLTGKSVELIDASAINAS 681

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 21/100 (21%)
Ig 130..200 CDD:143165 17/74 (23%)
I-set 226..310 CDD:254352 29/90 (32%)
IGc2 233..298 CDD:197706 23/69 (33%)
Ig 313..410 CDD:299845 27/105 (26%)
IG_like 325..410 CDD:214653 24/93 (26%)
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352 1/1 (100%)
Ig2_Robo 159..251 CDD:143201 1/1 (100%)
I-set 255..341 CDD:254352 22/105 (21%)
Ig3_Robo 272..341 CDD:143202 19/88 (22%)
IG_like 351..436 CDD:214653 28/89 (31%)
Ig 362..444 CDD:299845 27/82 (33%)
I-set 445..531 CDD:254352 26/104 (25%)
IGc2 459..521 CDD:197706 19/80 (24%)
FN3 549..637 CDD:238020 15/90 (17%)
FN3 673..762 CDD:238020 3/10 (30%)
fn3 770..855 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.