DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and CG13506

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster

Alignment Length:468 Identity:90/469 (19%)
Similarity:173/469 (37%) Gaps:90/469 (19%)


  Fly   111 EEPEFTEYIE-NVTVPAGRNVKLGCSVKNLG-SYKVAWMHFEQSAILTVHNHVITRNPRISVTHD 173
            |.|.:.:..: .|....|.:|.|.|..:|.. |..|.|  ::...|:....:.|::..:..:.:.
  Fly    67 EAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVW--YKNRIIIANGQNPISQRVQCMLNNS 129

  Fly   174 KHDRHRTWYLHINNVHEEDRGRYMCQI-----NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVRE 233
                     :.:.||..||...|.|:|     ...||......|:::..   |..::......|:
  Fly   130 ---------ILLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILCD---DRDITDRSQTFRQ 182

  Fly   234 GANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGV 298
            |.:..|.||........|||..:|     :|......:.:...:.:..:...:.|.|.|:|.:|.
  Fly   183 GDHHKLECRTYLPDNATIKWSFND-----LNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGS 242

  Fly   299 PPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKV 363
            .......:.:.|.:.|::......|...:|....:.|...|.|...:|:.: :|..:..|.||.:
  Fly   243 RHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIK-DGKTLQLSDKYSL 306

  Fly   364 EATVGLPAYKTHMKLTII--NVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTAS-------- 418
            :.:|    :..|.:.|:|  .|:..|.|.|.|..:|..|..:  ::::|||.|.|..        
  Fly   307 KDSV----HNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNE--VKVHVSYNPETPQFEDMTVEG 365

  Fly   419 ------------------------SGIYSTDTHWGENGINNNYAYGGPDS----------TRSIY 449
                                    :|.|:    |....:...:.:...|:          :|.::
  Fly   366 NKVTLHWLVRSHQLLSEAMLDYQLTGSYT----WSTVQVLETHRHNNTDNIWKITHQLELSRGVW 426

  Fly   450 ---AQDKNTRYQSNLNEIGLSE--QKSFLDKTQNPLLANGNANEAD--AESNGARGHNPSMAIAW 507
               .:.|||:..|:.:...:.|  :.|.:||.:...|......:|.  ..|.||......:.:. 
  Fly   427 HARVKTKNTKGWSHFSNDHVFEIPEDSEVDKDEEVELPPDEIVQAGIMPMSKGAASSMQRLNVG- 490

  Fly   508 LFVVIATLLLTIR 520
             .:::|.|||.:|
  Fly   491 -VILLAALLLRVR 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 21/103 (20%)
Ig 130..200 CDD:143165 15/71 (21%)
I-set 226..310 CDD:254352 15/84 (18%)
IGc2 233..298 CDD:197706 14/65 (22%)
Ig 313..410 CDD:299845 22/99 (22%)
IG_like 325..410 CDD:214653 20/87 (23%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 17/78 (22%)
IGc2 83..146 CDD:197706 16/74 (22%)
IG_like 176..254 CDD:214653 15/83 (18%)
Ig 176..239 CDD:299845 14/68 (21%)
I-set 258..349 CDD:254352 22/98 (22%)
Ig 275..348 CDD:143165 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80497700
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.