DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and CG13506

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:466 Identity:91/466 - (19%)
Similarity:173/466 - (37%) Gaps:86/466 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EEPEFTEYIE-NVTVPAGRNVKLGCSVKNLG-SYKVAWMHFEQSAILTVHNHVITRNPRISVTHD 173
            |.|.:.:..: .|....|.:|.|.|..:|.. |..|.|  ::...|:....:.|::..:..:.:.
  Fly    67 EAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVW--YKNRIIIANGQNPISQRVQCMLNNS 129

  Fly   174 KHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNI---DDSLSSSDVIVREGA 235
                     :.:.||..||...|.|:|.....: |...|.|....:|   |..::......|:|.
  Fly   130 ---------ILLRNVSPEDSDDYYCEILPQRVR-QHTALRVGARLSILCDDRDITDRSQTFRQGD 184

  Fly   236 NISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPP 300
            :..|.||........|||..:|     :|......:.:...:.:..:...:.|.|.|:|.:|...
  Fly   185 HHKLECRTYLPDNATIKWSFND-----LNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRH 244

  Fly   301 TVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEA 365
            .....:.:.|.:.|::......|...:|....:.|...|.|...:|:.: :|..:..|.||.::.
  Fly   245 PPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIK-DGKTLQLSDKYSLKD 308

  Fly   366 TVGLPAYKTHMKLTII--NVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTAS---------- 418
            :|    :..|.:.|:|  .|:..|.|.|.|..:|..|..:  ::::|||.|.|..          
  Fly   309 SV----HNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNE--VKVHVSYNPETPQFEDMTVEGNK 367

  Fly   419 ----------------------SGIYSTDTHWGENGINNNYAYGGPDS----------TRSIY-- 449
                                  :|.|:    |....:...:.:...|:          :|.::  
  Fly   368 VTLHWLVRSHQLLSEAMLDYQLTGSYT----WSTVQVLETHRHNNTDNIWKITHQLELSRGVWHA 428

  Fly   450 -AQDKNTRYQSNLNEIGLSE--QKSFLDKTQNPLLANGNANEAD--AESNGARGHNPSMAIAWLF 509
             .:.|||:..|:.:...:.|  :.|.:||.:...|......:|.  ..|.||......:.:.  .
  Fly   429 RVKTKNTKGWSHFSNDHVFEIPEDSEVDKDEEVELPPDEIVQAGIMPMSKGAASSMQRLNVG--V 491

  Fly   510 VVIATLLLTIR 520
            :::|.|||.:|
  Fly   492 ILLAALLLRVR 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 21/97 (22%)
Ig 130..200 CDD:143165 15/70 (21%)
I-set 226..310 CDD:254352 15/83 (18%)
IGc2 233..298 CDD:197706 13/64 (20%)
Ig 313..410 CDD:299845 22/98 (22%)
IG_like 325..410 CDD:214653 20/86 (23%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 16/77 (21%)
IGc2 83..146 CDD:197706 15/73 (21%)
IG_like 176..254 CDD:214653 15/82 (18%)
Ig 176..239 CDD:299845 13/67 (19%)
I-set 258..349 CDD:254352 22/97 (23%)
Ig 275..348 CDD:143165 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442837
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.