DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and wrapper

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster

Alignment Length:354 Identity:93/355 (26%)
Similarity:145/355 (41%) Gaps:53/355 (15%)


  Fly   106 LNIVVEEPEFTEYIEN--------VTVPAGRN--VKLGCSVKNLGSYKVAWMHFEQSAILTVHNH 160
            |..|..|.:|...:||        .||....|  |:|.|::.....| |.| |.:..|:      
  Fly    18 LGQVQAELDFNNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRY-VRW-HRDDVAL------ 74

  Fly   161 VITRNPRISVTHDKHDRHRTW---YLHINNVHEEDRGRYMCQINTVTAK-TQFGYLNVVVPPNID 221
            |.:|:|.:    ...||...|   .|.:.||...|.|.|.|::|:.:.. .|...:.|.:.|.: 
  Fly    75 VDSRHPEL----PPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQV- 134

  Fly   222 DSLSSSDVI-VREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRL 285
             .:..||:. .|.||...:.|.|.|.|:|:|.|:.:.|   .|.........:...|||.  ||.
  Fly   135 -LIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGN---VIQPQSNTGNRQSLILEIK--SRN 193

  Fly   286 DMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRG 350
            ..|...|:|||||.......:.:.|.|.|.:.||..:|....|....:||..||.|.:...|...
  Fly   194 QAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHH 258

  Fly   351 EGPI---IHD-SHKYKVEATVGLPAYKT---HMKLTIINVSSGDDGIYKCVAKNPRGETDGIIR- 407
            ..|:   .|. :|:.:::....:..|..   || |.:.:|.:.|.|.|:|.|.|......|.:. 
  Fly   259 GLPVALGAHSTTHESELQTNRSVDHYVNAVRHM-LVVKSVRNADMGQYECRASNQISVKSGSVEL 322

  Fly   408 -------LYVSYPPTTASSG---IYSTDT 426
                   |:...|.|.:|:.   ::.|::
  Fly   323 TGRPMPCLFKINPGTQSSTSHVLVWQTES 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/110 (26%)
Ig 130..200 CDD:143165 21/73 (29%)
I-set 226..310 CDD:254352 26/85 (31%)
IGc2 233..298 CDD:197706 22/65 (34%)
Ig 313..410 CDD:299845 27/112 (24%)
IG_like 325..410 CDD:214653 23/100 (23%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 26/95 (27%)
IG_like 41..118 CDD:214653 25/89 (28%)
IG_like 145..218 CDD:214653 24/78 (31%)
Ig 147..219 CDD:299845 24/77 (31%)
I-set 224..323 CDD:254352 25/100 (25%)
IGc2 236..314 CDD:197706 21/79 (27%)
FN3 339..431 CDD:238020 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.